Protein / Label:sp|P24298|ALAT1_HUMAN
Description:Alanine aminotransferase 1 OS=Homo sapiens GN=GPT PE=1 SV=3
Decoy:false
Note: 
File:GPT1_20151224_2016-02-08_09-39-34.sky.zip
0102030405060708090
MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNF
1 1 1 1 1 1 >>
100110120130140150160170180190
PDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELG
> 1 1
200210220230240250260270280290
AVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPY
1 1 1 1 <
300310320330340350360370380390
AGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEA
<< 1 1 1 1
400410420430440450460470480490
PGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLEYS
1 1 1 1
DescriptionAlanine aminotransferase 1 (short name: ALT1)
Gene name(s)GPT
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_005300.1
none loaded Q93076
P78398
P24298
D3DWM7
B0YJ18
ALAT1_HUMAN
ENST00000528431
ENST00000394955
none loaded GO:0042853
GO:0034641
GO:0030170
GO:0008652
GO:0006094
GO:0005829
GO:0004021
PeptidePeptide Neutral MassMissed CleavagesAvg. Measured RTPredicted RTRT Score
MASSTGDR823.34940   
VLTLDGMNPR1114.5805012.7320  
ALELEQELR1099.5873012.9422  
KPFTEVIR988.5706010.5690  
ANIGDAQAMGQRPITFLR1958.01560   
QVLALCVNPDLLSSPNFPDDAK2412.19950   
ILQACGGHSLGAYSVSSGIQLIR2386.24270   
LLVAGEGHTR1051.577408.9051  
AWALDVAELHR1279.66730   
ALCVINPGNPTGQVQTR1823.9312012.3203  
ECIEAVIR988.5012011.9494  
LFLLADEVYQDNVYAAGSQFHSFK2761.33880   
VLMEMGPPYAGQQELASFHSTSK2507.18250   
GYMGECGFR1075.4215011.4252  
GGYVEVVNMDAAVQQQMLK2079.01290   
QAVLAELAAK1012.5917012.7490  
AQELGLAPDMFFCLR1766.84840   
LLEETGICVVPGSGFGQR1917.9618014.3485  
EGTYHFR908.414109.1320  
MTILPPLEK1040.5940013.7648  

Peak Areas

Retention Times