Protein / Label:sp|P29965|CD40L_HUMAN
Description:CD40 ligand OS=Homo sapiens GN=CD40LG PE=1 SV=1
Decoy:false
Note: 
File:CD40L_20170419_2017-06-26_13-47-12.sky.zip
0102030405060708090
MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAANTH
1 1 1 1 1
100110120130140
SSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL
DescriptionCD40 ligand OS=Homo sapiens GN=CD40LG PE=1 SV=1
Gene name(s)CD40LG
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P29965
CD40L_HUMAN
none loaded none loaded none loaded

Peak Areas

Retention Times