0102030405060708090
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIP
<
100110120130140150160170180190
LENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCW
<< 1 1
200210220230240250260270280290
GAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
300310320330340350360370380390
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKE
400410420430440450460470480490
ITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCK
500510520530540550560570580590
ATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
600610620630640650660670680690
GENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPN
700710720730740750760770780790
QALLRILKETEFKKIVLGSGAFGTVYKGLWIPEGEVKIPVAIKELREATSPANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLD
800810820830840850860870880890
YVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
900910920930940950960970980990
GVTVWELMTFGSKPYDGIPASEISSILEGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSMARDPQRYLVIQGDERMHLPSPTDSNFYRA
1000101010201030104010501060107010801090
LMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKR
1100111011201130114011501160117011801190
PAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
1200
APQSSEFIGA
Features
DescriptionEpidermal growth factor receptor
Gene nameEGFR
Organism Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_005219.2
NP_958440.1
NP_958439.1
NP_958441.1
XP_005271805.1
none loaded O00688
O00732
P00533
P06268
Q14225
Q68GS5
Q92795
Q9BZS2
Q9GZX1
Q9H2C9
Q9H3C9
Q9UMD7
Q9UMD8
Q9UMG5
EGFR_HUMAN
ENST00000275493
ENST00000342916
ENST00000344576
ENST00000420316
none loaded GO:0000139
GO:0001503
GO:0001889
GO:0001892
GO:0001942
GO:0003682
GO:0003690
GO:0004709
GO:0004716
GO:0005006
GO:0005524
GO:0005615
GO:0005634
GO:0005768
GO:0005789
GO:0005976
GO:0006412
GO:0006970
GO:0006979
GO:0007202
GO:0007411
GO:0007435
GO:0007611
GO:0007623
GO:0008283
GO:0008543
GO:0009986
GO:0010008
GO:0010960
GO:0016021
GO:0016101
GO:0016323
GO:0016324
GO:0016337
GO:0019694
GO:0021795
GO:0030139
GO:0030324
GO:0030335
GO:0031659
GO:0031965
GO:0032930
GO:0033590
GO:0033594
GO:0035413
GO:0035690
GO:0038095
GO:0042059
GO:0042177
GO:0042698
GO:0042743
GO:0043006
GO:0043066
GO:0043406
GO:0043586
GO:0045087
GO:0045121
GO:0045429
GO:0045739
GO:0045740
GO:0045907
GO:0045909
GO:0045930
GO:0045944
GO:0046777
GO:0046982
GO:0048011
GO:0048015
GO:0048143
GO:0048146
GO:0048471
GO:0048546
GO:0048661
GO:0050679
GO:0050729
GO:0050730
GO:0050999
GO:0051015
GO:0051205
GO:0051592
GO:0051897
GO:0051968
GO:0060571
GO:0070141
GO:0070374
GO:0070435
GO:0071260
GO:0071364
GO:0071392
GO:0071549
Developmental protein
Kinase
Receptor
Transferase
Tyrosine-protein kinase
Display Chart Settings
 

Peak Areas

Retention Times