Chromatogram Library

This is an example of a Chromatogram Library folder in Panorama, and the result of completing the Panorama Chromatogram Libraries Tutorial.

Library Statistics:

View All
 
 
Protein Note/Annotations
CTCF      HsCD00078657 (2-D02) Stergachis-SupplementaryData_2_a.sky
E2F5      HsCD00302966 (8-E06) Stergachis-SupplementaryData_2_b.sky
ETS2      HsCD00301527 (1-C03) Stergachis-SupplementaryData_2_a.sky
EWSR1      HsCD00301321 (1-E06) Stergachis-SupplementaryData_2_a.sky
FOSB      HsCD00301650 (1-B08) Stergachis-SupplementaryData_2_a.sky
FOXD4L1      HsCD00302896 (8-G02) Stergachis-SupplementaryData_2_b.sky
GATA3      HsCD00305430 (10-D03) Stergachis-SupplementaryData_2_b.sky
IRF3      HsCD00079105 (1-F02) Stergachis-SupplementaryData_2_a.sky
MAD      HsCD00301407 (1-B05) Stergachis-SupplementaryData_2_a.sky
MAX      HsCD00301600 (1-A07) Stergachis-SupplementaryData_2_b.sky
MYC      HsCD00305678 (8-H03) Stergachis-SupplementaryData_2_b.sky
NR1I3      HsCD00304068 (9-F06) Stergachis-SupplementaryData_2_b.sky
NR2E1      HsCD00305417 (8-G05) Stergachis-SupplementaryData_2_b.sky
POU1F1      HsCD00302903 (8-G04) Stergachis-SupplementaryData_2_b.sky
POU3F4      HsCD00303140 (8-D08) Stergachis-SupplementaryData_2_b.sky
TAF11      HsCD00301672 (1-A03) Stergachis-SupplementaryData_2_a.sky
TP53      HsCD00078349 (2-E03) Stergachis-SupplementaryData_2_b.sky
XBP1      HsCD00301204 (1-D06) Stergachis-SupplementaryData_2_a.sky
ZMAT5      HsCD00301319 (1-E05) Stergachis-SupplementaryData_2_a.sky
View All
Peptide Note/Annotations
CTCF CDQCDYACR4965051246.41650  25.0130Quality Score: 1Stergachis-SupplementaryData_2_a.sky
CTCF CPDCDMAFVTSGELVR3233391855.79030  42.3704Quality Score: 1Stergachis-SupplementaryData_2_a.sky
CTCF CSMCDYASVEVSK3523651534.61020  34.4654Quality Score: 1Stergachis-SupplementaryData_2_a.sky
CTCF DPDYQPPAK1932021029.47670  25.5342Quality Score: 3Stergachis-SupplementaryData_2_a.sky
CTCF FHCPHCDTVIAR4364481511.67620  26.5643Quality Score: 1Stergachis-SupplementaryData_2_a.sky
CTCF FTQSGTMK415423898.42190  24.8384Quality Score: 1Stergachis-SupplementaryData_2_a.sky
CTCF HADNCAGPDGVEGENGGETK5725922012.81300  24.8724Quality Score: 1Stergachis-SupplementaryData_2_a.sky
CTCF HTENVAK429436797.40320  24.7963Quality Score: 4Stergachis-SupplementaryData_2_a.sky
CTCF HTHEKPFK3443521022.52980  24.7994Quality Score: 4Stergachis-SupplementaryData_2_a.sky
CTCF MEGDAVEAIVEESETFIK0181995.93470  24.9907Quality Score: 4Stergachis-SupplementaryData_2_a.sky
CTCF NHLNTHTGTRPHK3103231511.77060  46.2283Quality Score: 4Stergachis-SupplementaryData_2_a.sky
CTCF QHSYIEQGK4584671088.52510  24.7637Quality Score: 3Stergachis-SupplementaryData_2_a.sky
CTCF QLLDMHFK5355431030.52700  36.4861Quality Score: 1Stergachis-SupplementaryData_2_a.sky
CTCF SDLGVHLR449457895.48760  28.8680Quality Score: 3Stergachis-SupplementaryData_2_a.sky
CTCF SHTDERPHK2862951105.52650  24.3577Quality Score: 4Stergachis-SupplementaryData_2_a.sky
CTCF SHTGERPFQCSLCSYASR3713892141.93710  24.7531Quality Score: 4Stergachis-SupplementaryData_2_a.sky
CTCF TFQCELCSYTCPR2642771720.70070  37.8053Quality Score: 1Stergachis-SupplementaryData_2_a.sky
CTCF THSGEKPYECYICHAR3994152006.87270  45.1026Quality Score: 4Stergachis-SupplementaryData_2_a.sky
CTCF THTGEKPYACSHCDK5155301789.75120  24.6605Quality Score: 4Stergachis-SupplementaryData_2_a.sky
CTCF VVGNMKPPKPTK2442561294.74310  24.8102Quality Score: 1Stergachis-SupplementaryData_2_a.sky
CTCF YALIQHQK479487999.55020  25.4094Quality Score: 1Stergachis-SupplementaryData_2_a.sky
CTCF YCDAVFHER4704791195.50800  28.5533Quality Score: 1Stergachis-SupplementaryData_2_a.sky
CTCF YHDPNFVPAAFVCSK5445591750.81370  38.9469Quality Score: 1Stergachis-SupplementaryData_2_a.sky
E2F5 AAADTLAVR7786886.48720  11.5198Quality Score: 1Stergachis-SupplementaryData_2_b.sky
E2F5 AEIEDLELK1341431058.54960  25.5837Quality Score: 2Stergachis-SupplementaryData_2_b.sky
E2F5 DGVLDLK7077758.41740  25.2380Quality Score: 2Stergachis-SupplementaryData_2_b.sky
E2F5 FVSLLQEAK61701033.58080  26.2176Quality Score: 1Stergachis-SupplementaryData_2_b.sky
E2F5 GVGAGCNTK115124862.39670  3.4064Quality Score: 4Stergachis-SupplementaryData_2_b.sky
E2F5 IYDITNVLEGIDLIEK901061846.99280  39.3726Quality Score: 2Stergachis-SupplementaryData_2_b.sky
E2F5 LWLQQSIK1511591014.58620  25.8778Quality Score: 1Stergachis-SupplementaryData_2_b.sky
E2F5 NVMDDSINNR1591691176.51930  22.0865Quality Score: 1Stergachis-SupplementaryData_2_b.sky
E2F5 SHSGPIHVLLINK2182311413.80920  23.1815Quality Score: 4Stergachis-SupplementaryData_2_b.sky
E2F5 SLGLLTTK5361831.50660  24.0254Quality Score: 2Stergachis-SupplementaryData_2_b.sky
E2F5 SSMATQNLPEQHVSER2642801812.84250  15.3702Quality Score: 2Stergachis-SupplementaryData_2_b.sky
ETS2 ATFSGFK8491756.38060  30.0212Quality Score: 2Stergachis-SupplementaryData_2_a.sky
ETS2 AVMSQALK7684846.46330  25.6616Quality Score: 1Stergachis-SupplementaryData_2_a.sky
ETS2 FGMNGQMLCNLGK1311441468.66250  41.0875Quality Score: 1Stergachis-SupplementaryData_2_a.sky
ETS2 FLELAPDFVGDILWEHLEQMIK1461682642.34540  54.4135Quality Score: 4Stergachis-SupplementaryData_2_a.sky
ETS2 LADPDEVAR392401984.48760  26.3271Quality Score: 1Stergachis-SupplementaryData_2_a.sky
ETS2 MNDFGIK07823.38980  29.9027Quality Score: 4Stergachis-SupplementaryData_2_a.sky
ETS2 NMDQVAPVANSYR7201463.68270  31.8868Quality Score: 1Stergachis-SupplementaryData_2_a.sky
ETS2 SCQSFISWTGDGWEFK3763921933.83050  48.8065Quality Score: 1Stergachis-SupplementaryData_2_a.sky
EWSR1 AAVEWFDGK4234321021.48690  38.6598Quality Score: 1Stergachis-SupplementaryData_2_a.sky
EWSR1 AGDWQCPNPGCGNQNFAWR5175362233.91700  40.9742Quality Score: 1Stergachis-SupplementaryData_2_a.sky
EWSR1 APKPEGFLPPPFPPPGGDR5435621972.02070  40.9716Quality Score: 2Stergachis-SupplementaryData_2_a.sky
EWSR1 GDATVSYEDPPTAK4094231449.66240  29.3235Quality Score: 1Stergachis-SupplementaryData_2_a.sky
EWSR1 GGFGGGR606613606.28740  24.9686Quality Score: 4Stergachis-SupplementaryData_2_a.sky
EWSR1 GGMGAGER321329733.31770  24.9981Quality Score: 4Stergachis-SupplementaryData_2_a.sky
EWSR1 GGPGGMFR580588777.35920  29.7561Quality Score: 4Stergachis-SupplementaryData_2_a.sky
EWSR1 GGPGGMR564571630.29080  24.9975Quality Score: 4Stergachis-SupplementaryData_2_a.sky
EWSR1 GGPGGPGGPGGPMGR4704851206.55640  38.6943Quality Score: 4Stergachis-SupplementaryData_2_a.sky
EWSR1 GGPGGPPGPLMEQMGGR6146311593.73920  37.8343Quality Score: 1Stergachis-SupplementaryData_2_a.sky
EWSR1 GMPPPLR463470766.41600  28.3845Quality Score: 3Stergachis-SupplementaryData_2_a.sky
EWSR1 GNPSGGGNVQHR5055171178.55410  36.3976Quality Score: 4Stergachis-SupplementaryData_2_a.sky
EWSR1 KPPMNSMR446454959.46810  42.3251Quality Score: 4Stergachis-SupplementaryData_2_a.sky
EWSR1 SMSGPDNR292300862.36030  25.0563Quality Score: 4Stergachis-SupplementaryData_2_a.sky
EWSR1 TECNQCK536543938.35860  31.2134Quality Score: 4Stergachis-SupplementaryData_2_a.sky
EWSR1 TGQPMIHIYLDK3914031414.72790  37.5211Quality Score: 1Stergachis-SupplementaryData_2_a.sky
FOSB AELESEIAELQK1942061358.69290  40.2878Quality Score: 1Stergachis-SupplementaryData_2_a.sky
FOSB DLPGSAPAK239248854.44980  25.3260Quality Score: 4Stergachis-SupplementaryData_2_a.sky
FOSB EETLTPEEEEK1461571332.59330  26.9508Quality Score: 1Stergachis-SupplementaryData_2_a.sky
FOSB HQAETDQLEEEK1821941455.64780  25.0046Quality Score: 2Stergachis-SupplementaryData_2_a.sky
FOSB IPYEEGPGPGPLAEVR2232391679.85190  39.2808Quality Score: 1Stergachis-SupplementaryData_2_a.sky
FOSB LEFVLVAHKPGCK2102231496.81740  33.1177Quality Score: 3Stergachis-SupplementaryData_2_a.sky
FOSB MFQAFPGDYDSGSR0141576.66160  41.7065Quality Score: 4Stergachis-SupplementaryData_2_a.sky
FOSB TSGSDQPSDPLNSPSLLAR3193381940.94390  39.3875Quality Score: 1Stergachis-SupplementaryData_2_a.sky
FOXD4L1 DSDGEDGK1826821.30390  24.8864Quality Score: 4Stergachis-SupplementaryData_2_b.sky
FOXD4L1 EHIEGGGPSDPSEFGTEFR71902046.89190  26.0331Quality Score: 4Stergachis-SupplementaryData_2_b.sky
FOXD4L1 EPGHPGK170177720.35550  40.3012Quality Score: 4Stergachis-SupplementaryData_2_b.sky
FOXD4L1 FLEQSLQPGLQVAR49631584.86240  28.9280Quality Score: 1Stergachis-SupplementaryData_2_b.sky
FOXD4L1 FPAWQNSIR1471561117.56690  34.1975Quality Score: 4Stergachis-SupplementaryData_2_b.sky
FOXD4L1 GLASPPGGGCISFSIESIMQGVR3113342319.13510  24.7986Quality Score: 4Stergachis-SupplementaryData_2_b.sky
FOXD4L1 GTYWSLDPASQDMFDNGSFLR1771982406.05870  29.5207Quality Score: 4Stergachis-SupplementaryData_2_b.sky
FOXD4L1 HNLSLNDCFVK1561671345.64490  30.1748Quality Score: 1Stergachis-SupplementaryData_2_b.sky
FOXD4L1 IDVLGEEEDEDEVEDEEEEASQK26492664.09340  39.3234Quality Score: 4Stergachis-SupplementaryData_2_b.sky
FOXD4L1 LTLSGICAFISGR1271401393.73880  43.8525Quality Score: 1Stergachis-SupplementaryData_2_b.sky
FOXD4L1 QPAKPPYSYIALITMAILQSPHK1031262566.39820  39.3536Quality Score: 4Stergachis-SupplementaryData_2_b.sky
FOXD4L1 RPYALLHPHPPR2562681452.81020  28.6985Quality Score: 4Stergachis-SupplementaryData_2_b.sky
FOXD4L1 SAAASEDAR94103876.39370  25.0496Quality Score: 4Stergachis-SupplementaryData_2_b.sky
FOXD4L1 VGAAAVSGGGR395406900.47770  5.2169Quality Score: 4Stergachis-SupplementaryData_2_b.sky
FOXD4L1 WGGVALPR6371854.47630  31.6979Quality Score: 1Stergachis-SupplementaryData_2_b.sky
FOXD4L1 YLLLSAPAYAGAPK2682821433.79190  29.9641Quality Score: 1Stergachis-SupplementaryData_2_b.sky
GATA3 AGTSCANCQTTTTTLWR3133301927.85160  34.7547Quality Score: 4Stergachis-SupplementaryData_2_b.sky
GATA3 ALGSHHTASPWNLSPFSK1011191935.95910  50.8462Quality Score: 4Stergachis-SupplementaryData_2_b.sky
GATA3 DGTGHYLCNACGLYHK2772931864.79850  47.5933Quality Score: 4Stergachis-SupplementaryData_2_b.sky
GATA3 DVSPDPSLSTPGSAGSAR1591771699.80130  33.0102Quality Score: 1Stergachis-SupplementaryData_2_b.sky
GATA3 ECVNCGATSTPLWR2622761649.72900  36.9602Quality Score: 1Stergachis-SupplementaryData_2_b.sky
GATA3 LESSHSR195202814.39330  32.6577Quality Score: 4Stergachis-SupplementaryData_2_b.sky
GATA3 LHNINRPLTMK3473581335.74450  35.2456Quality Score: 4Stergachis-SupplementaryData_2_b.sky
GATA3 MEVTADQPR091045.48620  37.7053Quality Score: 4Stergachis-SupplementaryData_2_b.sky
GATA3 MNGQNRPLIKPK2933051394.78160  39.3082Quality Score: 4Stergachis-SupplementaryData_2_b.sky
GATA3 NANGDPVCNACGLYYK3313471814.77160  35.8315Quality Score: 1Stergachis-SupplementaryData_2_b.sky
GATA3 NSSFNPAALSR3883991162.57310  34.0361Quality Score: 1Stergachis-SupplementaryData_2_b.sky
GATA3 VHDSLEDFPK3783881185.56660  32.6659Quality Score: 3Stergachis-SupplementaryData_2_b.sky
GATA3 YQVPLPDSMK1851951176.58490  37.9619Quality Score: 1Stergachis-SupplementaryData_2_b.sky
IRF3 AGQWLWAQR2762851114.56720  40.5428Quality Score: 2Stergachis-SupplementaryData_2_a.sky
IRF3 DGQGCAHVPQGLGR3683821450.67350  27.4271Note: y7 contaminating
Quality Score: 1
Stergachis-SupplementaryData_2_a.sky
IRF3 DKPDLPTWK68771098.57100  33.5282Quality Score: 1Stergachis-SupplementaryData_2_a.sky
IRF3 DPHDPHK98105844.38280  25.9268Quality Score: 4Stergachis-SupplementaryData_2_a.sky
IRF3 EGGVFDLGPFIVGSWAPR3153331902.96280  53.9390Quality Score: 2Stergachis-SupplementaryData_2_a.sky
View All
Precursor Note/Annotations
CTCF CDQCDYACRCDQCDYACR2+light624.21551246.416521.6315 Stergachis-SupplementaryData_2_a.sky
CTCF CPDCDMAFVTSGELVRCPDCDMAFVTSGELVR2+light928.90241855.790330.7721 Stergachis-SupplementaryData_2_a.sky
CTCF CSMCDYASVEVSKCSMCDYASVEVSK2+light768.31241534.610225.9544 Stergachis-SupplementaryData_2_a.sky
CTCF DPDYQPPAKDPDYQPPAK2+light515.74561029.476718.3774 Stergachis-SupplementaryData_2_a.sky
CTCF FHCPHCDTVIARFHCPHCDTVIAR2+light756.84541511.676225.6104 Stergachis-SupplementaryData_2_a.sky
CTCF FTQSGTMKFTQSGTMK2+light450.2182898.421916.4115 Stergachis-SupplementaryData_2_a.sky
CTCF HADNCAGPDGVEGENGGETKHADNCAGPDGVEGENGGETK2+light1007.41382012.813033.1274 Stergachis-SupplementaryData_2_a.sky
CTCF HTENVAKHTENVAK2+light399.7089797.403214.8963 Stergachis-SupplementaryData_2_a.sky
CTCF HTHEKPFKHTHEKPFK2+light512.27221022.529818.2732 Stergachis-SupplementaryData_2_a.sky
CTCF MEGDAVEAIVEESETFIKMEGDAVEAIVEESETFIK2+light998.97461995.934732.8742 Stergachis-SupplementaryData_2_a.sky
CTCF NHLNTHTGTRPHKNHLNTHTGTRPHK2+light756.89261511.770625.6118 Stergachis-SupplementaryData_2_a.sky
CTCF QHSYIEQGKQHSYIEQGK2+light545.26981088.525119.2631 Stergachis-SupplementaryData_2_a.sky
CTCF QLLDMHFKQLLDMHFK2+light516.27081030.527018.3931 Stergachis-SupplementaryData_2_a.sky
CTCF SDLGVHLRSDLGVHLR2+light448.7511895.487616.3675 Stergachis-SupplementaryData_2_a.sky
CTCF SHTDERPHKSHTDERPHK2+light553.77051105.526519.5181 Stergachis-SupplementaryData_2_a.sky
CTCF SHTGERPFQCSLCSYASRSHTGERPFQCSLCSYASR2+light1071.97582141.937135.0643 Stergachis-SupplementaryData_2_a.sky
CTCF TFQCELCSYTCPRTFQCELCSYTCPR2+light861.35771720.700728.7457 Stergachis-SupplementaryData_2_a.sky
CTCF THSGEKPYECYICHARTHSGEKPYECYICHAR2+light1004.44362006.872733.0383 Stergachis-SupplementaryData_2_a.sky
CTCF THTGEKPYACSHCDKTHTGEKPYACSHCDK2+light895.88291789.751229.7815 Stergachis-SupplementaryData_2_a.sky
CTCF VVGNMKPPKPTKVVGNMKPPKPTK2+light648.37881294.743122.3564 Stergachis-SupplementaryData_2_a.sky
CTCF YALIQHQKYALIQHQK2+light500.7824999.550217.9285 Stergachis-SupplementaryData_2_a.sky
CTCF YCDAVFHERYCDAVFHER2+light598.76131195.508020.8678 Stergachis-SupplementaryData_2_a.sky
CTCF YHDPNFVPAAFVCSKYHDPNFVPAAFVCSK2+light876.41411750.813729.1974 Stergachis-SupplementaryData_2_a.sky
E2F5 AAADTLAVRAAADTLAVR2+light444.2509886.487216.2325 Stergachis-SupplementaryData_2_b.sky
E2F5 AEIEDLELKAEIEDLELK2+light530.28211058.549618.8135 Stergachis-SupplementaryData_2_b.sky
E2F5 DGVLDLKDGVLDLK2+light380.2160758.417414.3115 Stergachis-SupplementaryData_2_b.sky
E2F5 FVSLLQEAKFVSLLQEAK2+light517.79771033.580818.4389 Stergachis-SupplementaryData_2_b.sky
E2F5 GVGAGCNTKGVGAGCNTK2+light432.2056862.396715.8712 Stergachis-SupplementaryData_2_b.sky
E2F5 IYDITNVLEGIDLIEKIYDITNVLEGIDLIEK2+light924.50371846.992830.6401 Stergachis-SupplementaryData_2_b.sky
E2F5 LWLQQSIKLWLQQSIK2+light508.30041014.586218.1540 Stergachis-SupplementaryData_2_b.sky
E2F5 NVMDDSINNRNVMDDSINNR2+light589.26691176.519320.5830 Stergachis-SupplementaryData_2_b.sky
E2F5 SHSGPIHVLLINKSHSGPIHVLLINK2+light707.91191413.809224.1424 Stergachis-SupplementaryData_2_b.sky
E2F5 SLGLLTTKSLGLLTTK2+light416.7606831.506615.4078 Stergachis-SupplementaryData_2_b.sky
E2F5 SSMATQNLPEQHVSERSSMATQNLPEQHVSER2+light907.42851812.842530.1279 Stergachis-SupplementaryData_2_b.sky
ETS2 ATFSGFKATFSGFK2+light379.1976756.380614.2809 Stergachis-SupplementaryData_2_a.sky
ETS2 AVMSQALKAVMSQALK2+light424.2389846.463315.6322 Stergachis-SupplementaryData_2_a.sky
ETS2 FGMNGQMLCNLGKFGMNGQMLCNLGK2+light735.33851468.662524.9652 Stergachis-SupplementaryData_2_a.sky
ETS2 FLELAPDFVGDILWEHLEQMIKFLELAPDFVGDILWEHLEQMIK2+light1322.18002642.345442.5704 Stergachis-SupplementaryData_2_a.sky
ETS2 LADPDEVARLADPDEVAR2+light493.2511984.487617.7025 Stergachis-SupplementaryData_2_a.sky
ETS2 MNDFGIKMNDFGIK2+light412.7022823.389815.2861 Stergachis-SupplementaryData_2_a.sky
ETS2 NMDQVAPVANSYRNMDQVAPVANSYR2+light732.84861463.682724.8905 Stergachis-SupplementaryData_2_a.sky
ETS2 SCQSFISWTGDGWEFKSCQSFISWTGDGWEFK2+light967.92251933.830531.9427 Stergachis-SupplementaryData_2_a.sky
EWSR1 AAVEWFDGKAAVEWFDGK2+light511.75071021.486918.2575 Stergachis-SupplementaryData_2_a.sky
EWSR1 AGDWQCPNPGCGNQNFAWRAGDWQCPNPGCGNQNFAWR2+light1117.96582233.917036.4440 Stergachis-SupplementaryData_2_a.sky
EWSR1 APKPEGFLPPPFPPPGGDRAPKPEGFLPPPFPPPGGDR2+light987.01761972.020732.5155 Stergachis-SupplementaryData_2_a.sky
EWSR1 GDATVSYEDPPTAKGDATVSYEDPPTAK2+light725.83851449.662424.6802 Stergachis-SupplementaryData_2_a.sky
EWSR1 GGFGGGRGGFGGGR2+light304.1510606.287412.0295 Stergachis-SupplementaryData_2_a.sky
EWSR1 GGMGAGERGGMGAGER2+light367.6661733.317713.9350 Stergachis-SupplementaryData_2_a.sky
EWSR1 GGPGGMFRGGPGGMFR2+light389.6869777.359214.5956 Stergachis-SupplementaryData_2_a.sky
EWSR1 GGPGGMRGGPGGMR2+light316.1527630.290812.3896 Stergachis-SupplementaryData_2_a.sky
EWSR1 GGPGGPGGPGGPMGRGGPGGPGGPGGPMGR2+light604.28551206.556421.0336 Stergachis-SupplementaryData_2_a.sky
EWSR1 GGPGGPPGPLMEQMGGRGGPGGPPGPLMEQMGGR2+light797.87691593.739226.8413 Stergachis-SupplementaryData_2_a.sky
EWSR1 GMPPPLRGMPPPLR2+light384.2153766.416014.4315 Stergachis-SupplementaryData_2_a.sky
EWSR1 GNPSGGGNVQHRGNPSGGGNVQHR2+light590.28431178.554120.6135 Stergachis-SupplementaryData_2_a.sky
EWSR1 KPPMNSMRKPPMNSMR2+light480.7413959.468117.3272 Stergachis-SupplementaryData_2_a.sky
EWSR1 SMSGPDNRSMSGPDNR2+light432.1874862.360315.8706 Stergachis-SupplementaryData_2_a.sky
EWSR1 TECNQCKTECNQCK2+light470.1866938.358617.0106 Stergachis-SupplementaryData_2_a.sky
EWSR1 TGQPMIHIYLDKTGQPMIHIYLDK2+light708.37121414.727924.1561 Stergachis-SupplementaryData_2_a.sky
FOSB AELESEIAELQKAELESEIAELQK2+light680.35371358.692923.3156 Stergachis-SupplementaryData_2_a.sky
FOSB DLPGSAPAKDLPGSAPAK2+light428.2322854.449815.7520 Stergachis-SupplementaryData_2_a.sky
FOSB EETLTPEEEEKEETLTPEEEEK2+light667.30391332.593322.9241 Stergachis-SupplementaryData_2_a.sky
FOSB HQAETDQLEEEKHQAETDQLEEEK2+light728.83121455.647824.7699 Stergachis-SupplementaryData_2_a.sky
FOSB IPYEEGPGPGPLAEVRIPYEEGPGPGPLAEVR2+light840.93321679.851928.1330 Stergachis-SupplementaryData_2_a.sky
FOSB LEFVLVAHKPGCKLEFVLVAHKPGCK2+light749.41601496.817425.3875 Stergachis-SupplementaryData_2_a.sky
FOSB MFQAFPGDYDSGSRMFQAFPGDYDSGSR2+light789.33811576.661626.5851 Stergachis-SupplementaryData_2_a.sky
FOSB TSGSDQPSDPLNSPSLLARTSGSDQPSDPLNSPSLLAR2+light971.47921940.943932.0494 Stergachis-SupplementaryData_2_a.sky
FOXD4L1 DSDGEDGKDSDGEDGK2+light411.6592821.303915.2548 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 EHIEGGGPSDPSEFGTEFREHIEGGGPSDPSEFGTEFR2+light1024.45322046.891933.6386 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 EPGHPGKEPGHPGK2+light361.1850720.355513.7406 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 FLEQSLQPGLQVARFLEQSLQPGLQVAR2+light793.43851584.862426.7082 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 FPAWQNSIRFPAWQNSIR2+light559.79071117.566919.6987 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 GLASPPGGGCISFSIESIMQGVRGLASPPGGGCISFSIESIMQGVR2+light1160.57482319.135137.7222 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 GTYWSLDPASQDMFDNGSFLRGTYWSLDPASQDMFDNGSFLR2+light1204.03662406.058739.0261 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 HNLSLNDCFVKHNLSLNDCFVK2+light673.82971345.644923.1199 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 IDVLGEEEDEDEVEDEEEEASQKIDVLGEEEDEDEVEDEEEEASQK2+light1333.05402664.093442.8966 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 LTLSGICAFISGRLTLSGICAFISGR2+light697.87671393.738823.8413 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 QPAKPPYSYIALITMAILQSPHKQPAKPPYSYIALITMAILQSPHK2+light1284.20642566.398241.4312 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 RPYALLHPHPPRRPYALLHPHPPR2+light727.41241452.810224.7274 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 SAAASEDARSAAASEDAR2+light439.2041876.393716.0811 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 VGAAAVSGGGRVGAAAVSGGGR2+light451.2461900.477716.4424 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 WGGVALPRWGGVALPR2+light428.2454854.476315.7524 Stergachis-SupplementaryData_2_b.sky
FOXD4L1 YLLLSAPAYAGAPKYLLLSAPAYAGAPK2+light717.90321433.791924.4421 Stergachis-SupplementaryData_2_b.sky
GATA3 AGTSCANCQTTTTTLWRAGTSCANCQTTTTTLWR2+light964.93311927.851631.8530 Stergachis-SupplementaryData_2_b.sky
GATA3 ALGSHHTASPWNLSPFSKALGSHHTASPWNLSPFSK2+light968.98681935.959131.9746 Stergachis-SupplementaryData_2_b.sky
GATA3 DGTGHYLCNACGLYHKDGTGHYLCNACGLYHK2+light933.40651864.798530.9072 Stergachis-SupplementaryData_2_b.sky
GATA3 DVSPDPSLSTPGSAGSARDVSPDPSLSTPGSAGSAR2+light850.90791699.801328.4322 Stergachis-SupplementaryData_2_b.sky
GATA3 ECVNCGATSTPLWRECVNCGATSTPLWR2+light825.87181649.729027.6812 Stergachis-SupplementaryData_2_b.sky
GATA3 LESSHSRLESSHSR2+light408.2039814.393315.1511 Stergachis-SupplementaryData_2_b.sky
GATA3 LHNINRPLTMKLHNINRPLTMK2+light668.87951335.744522.9714 Stergachis-SupplementaryData_2_b.sky
GATA3 MEVTADQPRMEVTADQPR2+light523.75041045.486218.6175 Stergachis-SupplementaryData_2_b.sky
GATA3 MNGQNRPLIKPKMNGQNRPLIKPK2+light698.39811394.781623.8569 Stergachis-SupplementaryData_2_b.sky
GATA3 NANGDPVCNACGLYYKNANGDPVCNACGLYYK2+light908.39311814.771630.1568 Stergachis-SupplementaryData_2_b.sky
GATA3 NSSFNPAALSRNSSFNPAALSR2+light582.29381162.573120.3738 Stergachis-SupplementaryData_2_b.sky
GATA3 VHDSLEDFPKVHDSLEDFPK2+light593.79061185.566620.7187 Stergachis-SupplementaryData_2_b.sky
GATA3 YQVPLPDSMKYQVPLPDSMK2+light589.29971176.584920.5840 Stergachis-SupplementaryData_2_b.sky
IRF3 AGQWLWAQRAGQWLWAQR2+light558.29091114.567219.6537 Stergachis-SupplementaryData_2_a.sky
IRF3 DGQGCAHVPQGLGRDGQGCAHVPQGLGR2+light726.34401450.673524.6953 Stergachis-SupplementaryData_2_a.sky
IRF3 DKPDLPTWKDKPDLPTWK2+light550.29281098.571019.4138 Stergachis-SupplementaryData_2_a.sky
IRF3 DPHDPHKDPHDPHK2+light423.1987844.382815.6010 Stergachis-SupplementaryData_2_a.sky
IRF3 EGGVFDLGPFIVGSWAPREGGVFDLGPFIVGSWAPR2+light952.48871902.962831.4797 Stergachis-SupplementaryData_2_a.sky
Clustergrammer Heatmap
 
Download
Stergachis-SupplementaryData_2_b.sky2020-09-30 16:33:31101241248761
Stergachis-SupplementaryData_2_a.sky2020-09-30 16:32:35101151158461