Protein / Label:sp|Q04917|1433F_HUMAN
Description:14-3-3 protein eta OS=Homo sapiens GN=YWHAH PE=1 SV=4
Decoy:false
Note: 
File:Heavy-YWHAH_20151224_2016-02-08_09-41-32.sky.zip
0102030405060708090
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDV
1 1 1 1 1 1 1 >>
100110120130140150160170180190
LSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQA
> 1 1 1 1 1 <
200210220230240
FDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
<< 1 1 1
Description14-3-3 protein eta
Gene name(s)YWHAH
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_003396.1
none loaded Q04917
1433F_HUMAN
ENST00000248975
none loaded GO:2000649
GO:1900740
GO:0097193
GO:0086010
GO:0070062
GO:0048167
GO:0045893
GO:0042921
GO:0030659
GO:0019904
GO:0017080
GO:0014704
GO:0006886
GO:0006713
GO:0005886
GO:0005829
GO:0005159
GO:0050774

Peak Areas

Retention Times