Protein / Label:sp|P00533-4|EGFR_HUMAN
Description:Isoform 4 of Epidermal growth factor receptor OS=Homo sapiens GN=EGFR
Decoy:false
Note: 
File:EGFR_20151120_2015-12-03_21-13-34.sky.zip
0102030405060708090
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIP
1 1 1 1 1 1 <
100110120130140150160170180190
LENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCW
<< 1 1 1 1 1 1 >>
200210220230240250260270280290
GAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
> 1 1 1 1 1 <
300310320330340350360370380390
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKE
<< 1 1 1 1 1 1 <
400410420430440450460470480490
ITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCK
<< 1 1 1 1 1 1
500510520530540550560570580590
ATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
1 1 1 <
600610620
GENNTLVWKYADAGHVCHLCHPNCTYGS
<< 1 1
DescriptionIsoform 4 of Epidermal growth factor receptor OS=Homo sapiens GN=EGFR
Gene name(s)EGFR
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded none loaded none loaded none loaded none loaded none loaded
PeptidePeptide Neutral MassMissed CleavagesAvg. Measured RTPredicted RTRT Score
MRPSGTAGAALLALLAALCPASR2267.22420   
VCQGTSNK892.40730   
LTQLGTFEDHFLSLQR1903.97920   
MFNNCEVVLGNLEITYVQR2298.11370   
NYDLSFLK998.50730   
TIQEVAGYVLIALNTVER1988.09420   
IPLENLQIIR1207.72890   
GNMYYENSYALAVLSNYDANK2399.07400   
NLQEILHGAVR1248.69390   
FSNNPALCNVESIQWR1933.91050   
DIVSSDFLSNMSMDFQNHLGSCQK2759.19890   
CDPSCPNGSCWGAGEENCQK2311.83510   
IICAQQCSGR1191.54890   
SPSDCCHNQCAAGCTGPR2033.75600   
ESDCLVCR1037.42700   
DTCPPLMLYNPTTYQMDVNPEGK2683.19680   
YSFGATCVK1031.47460   
NYVVTDHGSCVR1405.64080   
ACGADSYEMEEDGVR1687.6454013.8128  
VCNGIGIGEFK1192.59100   
DSLSINATNIK1174.61940   
NCTSISGDLHILPVAFR1898.96730   
GDSFTHTPPLDPQELDILK2122.05830   
EITGFLLIQAWPENR1785.94140   
TDLHAFENLEIIR1569.81510   
QHGQFSLAVVSLNITSLGLR2139.18000   
EISDGDVIISGNK1345.67250   
NLCYANTINWK1395.66050   
LFGTSGQK836.43920   
ATGQVCHALCSPEGCWGPEPR2368.01470   
CNLLEGEPR1086.51280   
GPDNCIQCAHYIDGPHCVK2239.95610   
TCPAGVMGENNTLVWK1775.83350   
YADAGHVCHLCHPNCTYGS2217.87790   

Peak Areas

Retention Times