Protein / Label:sp|P0C0L4|CO4A_HUMAN
Description:Complement C4-A OS=Homo sapiens GN=C4A PE=1 SV=1
Decoy:false
Note: 
File:C4_20151120_2015-12-03_21-11-57.sky.zip
0102030405060708090
MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRNPSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLH
1 1 1 1 1 >>
100110120130140150160170180190
QLLRGPEVQLVAHSPWLKDSLSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYMPSSIFQD
> 1 1 1 1 1 <
200210220230240250260270280290
DFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPNFEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLE
<< 1 1 1 1 1 1 <
300310320330340350360370380390
SQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSWYFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASG
<< 1 1 1 1 1 1 >>
400410420430440450460470480490
IPVKVSATVSSPGSVPEVQDIQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDSRPPRVGDTLNLNLRAVGSGA
> 1 1 <
500510520530540550560570580590
TFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPSFYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVA
<< 1 1 1 1
600610620630640650660670680690
LGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQWTLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAK
1 1
700710720730740750760770780790
RCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLP
1 1 1 1 1 1 <
800810820830840850860870880890
DSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFS
<< 1 1 1 1
900910920930940950960970980990
VVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGV
1 1 1
1000101010201030104010501060107010801090
ASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKL
1 1 1 1 1 1
1100111011201130114011501160117011801190
QETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYAL
1 1 1 >>
1200121012201230124012501260127012801290
SLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFR
> 1 1
1300131013201330134013501360137013801390
STQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIE
1 1 1 1 1 1 >>
1400141014201430144014501460147014801490
VTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRAD
> 1 1 1 1 1
1500151015201530154015501560157015801590
LEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRR
1 1 1 1
1600161016201630164016501660167016801690
ALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQ
1 1 1 1 1
17001710172017301740
YLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
1
DescriptionComplement C4-A OS=Homo sapiens GN=C4A PE=1 SV=1
Gene name(s)C4A
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P0C0L4
CO4A_HUMAN
none loaded none loaded none loaded
LLWGLIWASSFFTLSLQKPR2362.32020   
NNVPCSPK914.428007.9257  
VDFTLSSER1052.5138012.1578  
DFALLSLQVPLK1342.7860016.8811  
SCGLHQLLR1082.5655011.1346  
GPEVQLVAHSPWLK1559.8460013.6556  
TTNIQGINLLFSSR1562.8417015.4789  
GHLFLQTDQPIYNPGQR1982.9963012.9750  
VFALDQK819.4491011.3760  
MRPSTDTITVMVENSHGLR2143.0514013.0016  
EVYMPSSIFQDDFVIPDISEPGTWK2899.3626017.9558  
FSDGLESNSSTQFEVK1773.80570   
YVLPNFEVK1107.5964014.0698  
ITPGKPYILTVPGHLDEMQLDIQAR2804.48950   
YIYGKPVQGVAYVR1611.8773011.8682  
FGLLDEDGK992.4815013.0356  
GLESQTK761.391907.3158  
LVNGQSHISLSK1281.704109.9276  
AEFQDALEK1049.5029011.4978  
LNMGITDLQGLR1329.7075014.4109  
HLVPGAPFLLQALVR1629.9719016.6827  
EMSGSPASGIPVK1258.6227010.9845  
LTVAAPPSGGPGFLSIERPDSRPPR2573.37140   
VGDTLNLNLR1113.6142012.9452  
AVGSGATFSHYYYMILSR2021.9669015.3754  
GQIVFMNR963.4960012.2569  
VDVQAGACEGK1132.518308.6066  
LELSVDGAK930.50220   
SHKPLNMGK1010.533107.7161  
LGQYASPTAK1034.539709.3152  
CCQDGVTR994.396007.3097  
VQQPDCR901.407607.2489  
EPFLSCCQFAESLR1742.77560   
GQAGLQR728.39290   
ALEILQEEDLIDEDDIPVR2224.1111016.0040  
SFFPENWLWR1380.6615017.1508  
FQILTLWLPDSLTTWEIHGLSLSK2797.50550   
GLCVATPVQLR1212.6649012.9045  
EFHLHLR950.5086011.1996  
FEQLELRPVLYNYLDK2039.07280   
GSFEFPVGDAVSK1338.6456013.6976  
EELVYELNPLDHR1625.8049014.3775  
TLEIPGNSDPNMIPDGDFNSYVR2550.16970   
GCGEQTMIYLAPTLAASR1937.93390   
TEQWSTLPPETK1415.69330   
DHAVDLIQK1037.55060   
ADGSYAAWLSR1195.56220   
DSSTWLTAFVLK1366.71330   
VLSLAQEQVGGSPEK1540.80970   
VEASISK732.40180   
ANSFLGEK864.43410   
ASAGLLGAHAAAITAYALSLTK2070.14730   
AEMADQASAWLTR1448.67180   
QGSFQGGFR982.46210   
STQDTVIALDALSAYWIASHTTEER2777.35080   
GLNVTLSSTGR1103.59350   
SHALQLNNR1051.55230   
GLEEELQFSLGSK1435.71950   
TYNVLDMK982.4794012.6513  
NTTCQDLQIEVTVK1647.81380   
GHVEYTMEANEDYEDYEYDELPAK2909.18620   
DDPDAPLQPVTPLQLFEGR2107.05860   
VVEEQESR974.466907.2638  
VHYTVCIWR1232.6124012.7049  
VGLSGMAIADVTLLSGFHALR2127.1510017.5048  
LTSLSDR790.418509.1418  
YVSHFETEGPHVLLYFDSVPTSR2679.2969014.6675  
CSVFYGAPSK1114.5117011.2745  
LLATLCSAEVCQCAEGK1908.8744012.7466  
GLQDEDGYR1051.457109.6496  
FACYYPR975.4273011.4061  
VEYGFQVK968.4967011.9309  
ITQVLHFTK1085.6233011.5216  
AAANQMR760.365007.0377  
AACAQLNDFLQEYGTQGCQV2271.9889015.7803  

Peak Areas

Retention Times