sasp_panel_atazanavir_2019-02-26_11-45-06.sky.zip

SASP_Atlas_Buck
sasp_panel_atazanavir_2019-02-26_11-45-06.sky.zip   1 version
 
376 proteins, 15,601 peptides, 23,172 precursors, 301,032 transitions  -  0 replicates  -  Skyline-daily (64-bit) 4.2.1.19004
Protein / LabelDescriptionProtein Annotations 
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+M443.7407 
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+M+1444.2421 
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+M+2444.7433 
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+y6701.39411+
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+y5588.31001+
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+y4474.26711+
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+y3403.23001+
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+y1175.11901+
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+y6351.20072+
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+b2186.08731+
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+b3299.17141+
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+b4413.21431+
ANLNALDR0885.4668 ANLNALDRlight885.4668443.74072+b5484.25141+
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+M539.7894 
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+M+1540.0402 
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+M+2540.2908 
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+y8881.53161+
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+y7784.47881+
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+y5584.36271+
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+y4485.29431+
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+y2272.17171+
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+y1175.11901+
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+y8441.26942+
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+b2129.06591+
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+b3276.13431+
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight2155.1287539.78944+b4347.17141+
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+M488.7278 
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+M+1489.2292 
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+M+2489.7305 
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+y7701.32131+
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+y6630.28421+
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+y5573.26271+
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+y4458.23581+
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+y3343.20881+
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+y2272.17171+
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+y1175.11901+
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+y8424.69852+
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+b3276.13431+
AGFAGDDAPR0975.4410 AGFAGDDAPRlight975.4410488.72782+b4347.17141+
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+M473.2795 
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+M+1473.7809 
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+M+2474.2822 
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+y7775.44611+
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+y6628.37771+
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+y5531.32491+
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+y4444.29291+
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+y3331.20881+
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+y1175.11901+
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+y7388.22672+
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+y6314.69252+
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+b2171.11281+
AVFPSIVGR0944.5444 AVFPSIVGRlight944.5444473.27952+b3318.18121+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+M599.8564 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+M+1600.3578 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+M+2600.8592 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+y8881.53161+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+y7784.47881+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+y6697.44681+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+y5584.36271+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+y4485.29431+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+y2272.17171+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+y1175.11901+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+y9514.80362+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+y8441.26942+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982599.85642+b2171.11281+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+M400.2400 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+M+1400.5743 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+M+2400.9085 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+y7784.47881+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+y5584.36271+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+y4485.29431+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+y2272.17171+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+y1175.11901+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+y9514.80362+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+y8441.26942+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+y7392.74302+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+b2171.11281+
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight1197.6982400.24003+b3318.18121+
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+M400.7713 
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+M+1401.2727 
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+M+2401.7740 
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+y6644.43411+
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+y3361.24451+
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+y2260.19691+
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+y1147.11281+
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+b1157.10841+
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+b2214.12991+
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+b3327.21391+
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+b4440.29801+
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+b5541.34571+
RGILTLK1799.5280 RGILTLKlight799.5280400.77132+b6654.42971+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+M758.3782 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+M+1758.8797 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+M+2759.3810 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+y91216.58581+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+y81079.52691+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+y7942.46801+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+y6841.42031+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+y5694.35191+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+y4531.28851+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+y2288.20301+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+y1175.11901+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+y9608.79652+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419758.37822+b3437.22961+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+M505.9212 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+M+1506.2555 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+M+2506.5898 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+y81079.52691+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+y7942.46801+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+y6841.42031+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+y5694.35191+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+y4531.28851+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+y2288.20301+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+y1175.11901+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+y10701.83622+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+y9608.79652+
IWHHTFYNELR01514.7419 IWHHTFYNELRlight1514.7419505.92123+y8540.26712+
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+M653.3580 
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+M+1653.6923 
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+M+2654.0265 
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+y4471.29261+
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+y3358.20851+
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+y2244.16561+
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+y1147.11281+
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+b2171.11281+
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+b6663.30971+
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+b9972.51491+
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+b101085.59901+
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+b4199.10772+
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight1957.0520653.35803+b10543.30312+
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+M400.7405 
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+M+1401.2418 
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+M+2401.7431 
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+y6644.37261+
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+y5531.28851+
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+y4416.26161+
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+y3303.17751+
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+y1175.11901+
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+b1157.10841+
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+b3385.21941+
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+b4498.30351+
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+b5569.34061+
RLDLAGR1799.4664 RLDLAGRlight799.4664400.74052+b6626.36201+
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+M565.3324 
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+M+1565.8339 
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+M+2566.3352 
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+y4517.33441+
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+y2276.15541+
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+y1147.11281+
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+b1130.04991+
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+b2243.13391+
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+b5613.33041+
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+b6726.41451+
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+b7854.50941+
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+b8983.55201+
EIVRDIKEK21128.6503 EIVRDIKEKlight1128.6503565.33242+b8492.27962+
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+M860.0732 
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+M+1860.4075 
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+M+2860.7415 
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+y111079.55791+
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+y101008.52081+
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+y9907.47311+
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+b2274.12201+
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+b3437.18531+
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+b4536.25371+
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+b5607.29081+
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+b6720.37491+
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+b14836.37332+
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight2577.1979860.07323+b181008.45812+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+M895.9496 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+M+1896.4511 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+M+2896.9524 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+y121298.66991+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+y101086.59021+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+y8901.51021+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+y7802.44171+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+y6689.35771+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+y5588.31001+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+y4475.22591+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+y12649.83862+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+b2251.10261+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846895.94962+b3380.14521+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+M597.6355 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+M+1597.9698 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+M+2598.3040 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+y7802.44171+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+y6689.35771+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+y5588.31001+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+y4475.22591+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+y12649.83862+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+b2251.10261+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+b3380.14521+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+b4493.22931+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+b8890.38901+
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight1789.8846597.63553+b9989.45751+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+M698.6920 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+M+1699.0263 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+M+2699.3605 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+y2322.18741+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+y1175.11901+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+y16922.48672+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+y15857.96542+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+y14801.42342+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+y13752.89702+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+y12695.38352+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+b2251.10261+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+b3380.14521+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542698.69203+b4493.22931+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+M524.2708 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+M+1524.5215 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+M+2524.7722 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+y1175.11901+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+y13752.89702+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+y10602.84352+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+y9553.30932+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+y8496.76722+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+y6389.70142+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+b2251.10261+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+b3380.14521+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+b4493.22931+
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight2093.0542524.27084+b8890.38901+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+M902.6629 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+M+1902.9137 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+M+2903.1641 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+y8941.47611+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+y2278.15331+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+b2304.17681+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+b3464.20741+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+b5690.30281+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+b6761.33991+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+b7874.42401+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+b81021.49241+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+b91149.55101+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226902.66294+b7437.71562+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+M722.3318 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+M+1722.5324 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+M+2722.7327 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+b2304.17681+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+b3464.20741+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+b5690.30281+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+b6761.33991+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+b7874.42401+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+b81021.49241+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+b7437.71562+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+b8511.24982+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+b9575.27912+
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight3606.6226722.33185+b12777.35502+
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+M826.8706 
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+M+1827.1213 
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+M+2827.3717 
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+y8941.47611+
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+y2278.15331+
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+b2258.09071+
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+b3387.13331+
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+b4458.17041+
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+b5571.25451+
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+b6718.32291+
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+b7846.38151+
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+b6359.66512+
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight3303.4531826.87064+b181049.44872+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+M822.9025 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+M+1823.4039 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+M+2823.9052 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+y121387.69651+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+y111224.63311+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+y101109.60621+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+y9980.56361+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+y8893.53161+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+y7836.51011+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+y4539.34121+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+y3440.27281+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+y2303.21391+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903822.90252+b2258.10841+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+M548.9374 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+M+1549.2717 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+M+2549.6059 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+y6739.45731+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+y5652.42531+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+y4539.34121+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+y3440.27281+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+y12694.35192+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+y11612.82022+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+y10555.30672+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+y9490.78542+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+y8447.26942+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903548.93743+y7418.75872+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+M411.9549 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+M+1412.2056 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+M+2412.4562 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+y6739.45731+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+y5652.42531+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+y4539.34121+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+y3440.27281+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+y9490.78542+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+y8447.26942+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+y7418.75872+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+b2258.10841+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+b4536.19871+
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight1643.7903411.95494+b5665.24131+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+M758.8550 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+M+1759.3564 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+M+2759.8577 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+y111259.60151+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+y101096.53821+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+y9981.51121+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+y8852.46861+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+y7765.43661+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+y6708.41511+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+y3411.24631+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+y2312.17791+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+y1175.11901+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954758.85502+b2258.10841+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+M506.2391 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+M+1506.5734 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+M+2506.9076 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+y6708.41511+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+y5611.36241+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+y4524.33031+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+y3411.24631+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+y2312.17791+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+y1175.11901+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+y11630.30442+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+y10548.77272+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+y8426.73802+
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight1515.6954506.23913+y6354.71122+
sp|O00151|PDLI1_HUMAN PDZ and LIM domain protein 1 OS=Homo sapiens GN=PDLIM1 PE=1 SV=4
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+M815.4516 
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+M+1815.9530 
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+M+2816.4544 
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+y131417.74341+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+y101175.60551+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+y91060.57861+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+y8913.51021+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+y7784.46761+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+y6656.40901+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+y4446.27221+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+y2262.15101+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+y1175.11901+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886815.45162+y13709.37532+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+M543.9701 
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+M+1544.3044 
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+M+2544.6387 
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+y6656.40901+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+y5559.35621+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+y4446.27221+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+y3375.23501+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+y2262.15101+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+y1175.11901+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+y13709.37532+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+y6328.70812+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+b2213.15981+
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight1628.8886543.97013+b9974.49421+
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+M588.3064 
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+M+1588.8078 
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+M+2589.3092 
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+y8913.51021+
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+y7784.46761+
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+y6656.40901+
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+y4446.27221+
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+y3375.23501+
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+y2262.15101+
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+y1175.11901+
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+b2263.10261+
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+b3392.14521+
DFEQPLAISR01174.5982 DFEQPLAISRlight1174.5982588.30642+b4520.20381+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+M1104.8698 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+M+11105.2040 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+M+21105.5381 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+y151701.76091+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+y8968.49081+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+y7867.44311+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+y6730.38421+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+y5617.30021+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+y4488.25761+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+y231243.58242+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+b3256.16561+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+b5441.24561+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.58741104.86983+b6554.32971+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+M828.9041 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+M+1829.1548 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+M+2829.4054 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+y8968.49081+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+y7867.44311+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+y6730.38421+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+y5617.30021+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+y4488.25761+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+y16908.89762+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+y15851.38412+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+b3256.16561+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+b10999.49281+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3311.5874828.90414+b111098.56121+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+M1110.2014 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+M+11110.5357 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+M+21110.8697 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+y7867.44311+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+y6730.38421+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+y5617.30021+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+y4488.25761+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+y1175.11901+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+y251388.13732+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+y231251.57992+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+y211165.55572+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+b3256.16561+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.58241110.20143+b6554.32971+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+M832.9029 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+M+1833.1536 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+M+2833.4041 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+y7867.44311+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+y6730.38421+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+y5617.30021+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+y4488.25761+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+y16916.89502+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+y15859.38162+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+b3256.16561+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+b8827.44441+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+b10999.49281+
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3327.5824832.90294+b111098.56121+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+M781.4220 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+M+1781.9234 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+M+2782.4242 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+y121320.65761+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+y101103.60551+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+y91002.55781+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+y8887.53091+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+y7773.48801+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+y6660.40391+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+y4446.27221+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+y1175.11901+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+y13724.87992+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294781.42202+b2242.18631+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+M521.2837 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+M+1521.6180 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+M+2521.9519 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+y6660.40391+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+y5559.35621+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+y4446.27221+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+y3345.22451+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+y2246.15611+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+y1175.11901+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+y3173.11592+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+b7789.35601+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+b8902.44001+
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight1560.8294521.28373+b9502.24752+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+M660.8325 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+M+1661.3338 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+M+2661.8344 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+y101103.60551+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+y91002.55781+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+y8887.53091+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+y7773.48801+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+y6660.40391+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+y5559.35621+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+y4446.27221+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+y2246.15611+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+y1175.11901+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503660.83252+b2218.05941+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+M440.8907 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+M+1441.2250 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+M+2441.5587 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+y6660.40391+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+y5559.35621+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+y4446.27221+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+y3345.22451+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+y2246.15611+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+y1175.11901+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+b2218.05941+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+b5548.17691+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+b6661.26101+
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight1319.6503440.89073+b7381.65802+
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+M627.9988 
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+M+1628.3331 
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+M+2628.6673 
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+y91028.57351+
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+y7818.43671+
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+y6719.36821+
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+y5618.32061+
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+y4489.27801+
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+y3360.23541+
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+y1175.11901+
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+b3354.14081+
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+b5581.30421+
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight1880.9745627.99883+b7854.41551+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+M700.8803 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+M+1701.3817 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+M+2701.8831 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+y101115.60551+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+y91028.57351+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+y7818.43671+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+y6719.36821+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+y1175.11901+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+y10558.30642+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+y9514.79042+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+b2286.15501+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+b3373.18701+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460700.88032+b3187.09722+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+M467.5893 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+M+1467.9236 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+M+2468.2578 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+y8931.52071+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+y7818.43671+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+y6719.36821+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+y4489.27801+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+y1175.11901+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+y11651.34612+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+y10558.30642+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+y9514.79042+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+b2286.15501+
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight1399.7460467.58933+b3187.09722+
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+M622.8297 
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+M+1623.3312 
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+M+2623.8326 
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+y9959.50441+
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+y8872.47241+
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+y6662.33551+
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+y5563.26711+
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+y3333.17691+
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+y2204.13431+
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+y8436.73982+
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+b2286.15501+
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+b3373.18701+
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight1243.6449622.82972+b3187.09722+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+M1052.0236 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+M+11052.5250 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+M+21053.0261 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+y151673.83541+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+y131457.76081+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+y101103.60691+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+y91004.53841+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+y8891.45441+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+y7754.39551+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+y6641.31141+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+y13729.38402+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+b2246.09071+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.03271052.02362+b3359.17481+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+M701.6848 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+M+1702.0191 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+M+2702.3531 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+y91004.53841+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+y8891.45441+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+y7754.39551+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+y6641.31141+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+y17929.48192+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+y16872.93992+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+y15837.42132+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+y13729.38402+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+b2246.09071+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327701.68483+b3359.17481+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+M526.5155 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+M+1526.7662 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+M+2527.0167 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+y91004.53841+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+y8891.45441+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+y7754.39551+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+y6641.31141+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+y15837.42132+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+y13729.38402+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+y11616.82842+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+y8446.23082+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+b2246.09071+
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2102.0327526.51554+b3359.17481+
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+M530.5142 
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+M+1530.7649 
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+M+2531.0154 
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+y7754.39551+
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+y6641.31141+
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+y1175.11901+
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+y13729.38402+
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+y11616.82842+
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+y8446.23082+
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+b2262.08561+
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+b3375.16971+
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+b4446.20681+
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight2118.0276530.51424+b6662.28141+
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+M799.8776 
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+M+1800.3790 
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+M+2800.8798 
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+y131293.64341+
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+y121196.59061+
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+y111049.52221+
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+y10948.47451+
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+y9877.43741+
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+y8790.40541+
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+y1175.11901+
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+y14720.84302+
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+y13647.32532+
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight1597.7406799.87762+b3306.11181+
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+M791.8801 
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+M+1792.3816 
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+M+2792.8824 
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+y131293.64341+
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+y121196.59061+
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+y111049.52221+
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+y10948.47451+
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+y9877.43741+
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+y8790.40541+
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+y1175.11901+
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+y14712.84562+
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+y13647.32532+
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight1581.7457791.88012+b2159.07641+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+M1034.4985 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+M+11034.8328 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+M+21035.1671 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+y101123.53781+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+y91036.50581+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+y8922.46291+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+y7775.39451+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+y5547.30861+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+y4476.27151+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+y3363.18741+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+y2234.14481+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+b2213.15981+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.47381034.49853+b8947.45811+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+M776.1257 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+M+1776.3764 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+M+2776.6271 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+y101123.53781+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+y91036.50581+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+y8922.46291+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+y7775.39451+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+y4476.27151+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+y3363.18741+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+y2234.14481+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+b2213.15981+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+b5556.30891+
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3100.4738776.12574+b8947.45811+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+M887.4595 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+M+1887.7937 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+M+2888.1280 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+y9955.54591+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+y8858.49311+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+y3375.22381+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+y2262.13971+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+y1147.11281+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+y231209.12462+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+b2173.09211+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+b3244.12921+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+b141369.67061+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566887.45953+b17853.41632+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+M665.8464 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+M+1666.0971 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+M+2666.3478 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+y9955.54591+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+y8858.49311+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+y4474.29221+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+y3375.22381+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+y2262.13971+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+y1147.11281+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+y9478.27662+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+b2173.09211+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+b3244.12921+
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight2659.3566665.84644+b4331.16121+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+M1132.5741 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+M+11132.9084 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+M+21133.2427 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+y151690.88981+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+y6754.36181+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+y2310.17611+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+y15845.94852+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+b2173.09211+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+b3244.12921+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+b141369.67061+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+b171705.82521+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+b15753.86842+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.70051132.57413+b17853.41632+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.7005849.68244+M849.6824 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.7005849.68244+M+1849.9331 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.7005849.68244+M+2850.1838 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3394.7005849.68244+y151690.88981+
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005