sasp_panel_ras_2019-02-26_13-24-23.sky.zip

SASP_Atlas_Buck
Name: sasp_panel_ras_2019-02-26_13-24-23.sky.zip (51 MB)   1 version
 
747 proteins, 30,025 peptides, 44,411 precursors, 576,866 transitions  -  0 replicates  -  Skyline-daily (64-bit) 4.2.1.19004
Protein / LabelDescriptionProtein Note/Annotations 
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
ANLNALDR0885.4668 ANLNALDRlight2+443.7407885.46681316.2172 
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight4+539.78942155.12871322.7930 
AGFAGDDAPR0975.4410 AGFAGDDAPRlight2+488.7278975.44101317.5668 
AVFPSIVGR0944.5444 AVFPSIVGRlight2+473.2795944.54441317.1034 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight2+599.85641197.69821320.9007 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight3+400.24001197.69821317.4901 
RGILTLK1799.5280 RGILTLKlight2+400.7713799.52801314.9281 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight2+758.37821514.74191325.6563 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight3+505.92121514.74191321.5060 
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight3+653.35801957.05201327.1086 
RLDLAGR1799.4664 RLDLAGRlight2+400.7405799.46641314.9272 
EIVRDIKEK21128.6503 EIVRDIKEKlight2+565.33241128.65031319.8650 
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight3+860.07322577.19791334.9638 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight2+895.94961789.88461329.7835 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight3+597.63551789.88461324.9911 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight3+698.69202093.05421328.8313 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight4+524.27082093.05421322.2033 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight4+902.66293606.62261336.5822 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight5+722.33183606.62261329.7296 
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight4+826.87063303.45311333.7021 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight2+822.90251643.79031327.5921 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight3+548.93741643.79031323.1406 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight4+411.95491643.79031317.9353 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight2+758.85501515.69541325.6706 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight3+506.23911515.69541321.5181 
sp|O00151|PDLI1_HUMAN PDZ and LIM domain protein 1 OS=Homo sapiens GN=PDLIM1 PE=1 SV=4
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight2+815.45161628.88861327.3685 
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight3+543.97011628.88861322.9519 
DFEQPLAISR01174.5982 DFEQPLAISRlight2+588.30641174.59821320.5542 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3+1104.86983311.58741344.2661 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight4+828.90413311.58741333.7794 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3+1110.20143327.58241344.4687 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight4+832.90293327.58241333.9313 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight2+781.42201560.82941326.3477 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight3+521.28371560.82941322.0898 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight2+660.83251319.65031322.7300 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight3+440.89071319.65031319.0348 
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight3+627.99881880.97451326.1450 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight2+700.88031399.74601323.9314 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight3+467.58931399.74601320.0494 
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight2+622.82971243.64491321.5899 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2+1052.02362102.03271334.4657 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight3+701.68482102.03271328.9450 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight4+526.51552102.03271322.2886 
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight4+530.51422118.02761322.4405 
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight2+799.87761597.74061326.9013 
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight2+791.88011581.74571326.6614 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3+1034.49853100.47381341.5919 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight4+776.12573100.47381331.7738 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight3+887.45952659.35661336.0045 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight4+665.84642659.35661327.5832 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3+1132.57413394.70051345.3188 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight4+849.68243394.70051334.5689 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight5+679.94743394.70051328.1190 
PLDHAQPPSSLVIDK01615.8570 PLDHAQPPSSLVIDKlight3+539.62631615.85701322.7868 
QELNEPPKQSTSFLVLQEILESEEK12914.4811 QELNEPPKQSTSFLVLQEILESEEKlight3+972.50102914.48111339.2360 
QELNEPPK0953.4818 QELNEPPKlight2+477.7482953.48181317.2374 
QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFR23969.9960 QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRlight4+993.50633969.99601340.0342 
QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFR23969.9960 QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRlight5+795.00653969.99601332.4912 
QSTSFLVLQEILESEEKGDPNKPSGFR13034.5247 QSTSFLVLQEILESEEKGDPNKPSGFRlight3+1012.51553034.52471340.7566 
QSTSFLVLQEILESEEKGDPNKPSGFR13034.5247 QSTSFLVLQEILESEEKGDPNKPSGFRlight4+759.63853034.52471331.1473 
QSTSFLVLQEILESEEKGDPNKPSGFR13034.5247 QSTSFLVLQEILESEEKGDPNKPSGFRlight5+607.91223034.52471325.3817 
QSTSFLVLQEILESEEK01979.0099 QSTSFLVLQEILESEEKlight2+990.51221979.00991332.6204 
QSTSFLVLQEILESEEK01979.0099 QSTSFLVLQEILESEEKlight3+660.67721979.00991327.3867 
VAASIGNAQK0957.5243 VAASIGNAQKlight2+479.7694957.52431317.2981 
CGTGIVGVFVK01135.6060 CGTGIVGVFVKlight2+568.81031135.60601319.9693 
HRHPECYVCTDCGTNLK12145.9143 HRHPECYVCTDCGTNLKlight3+716.31202145.91431329.5009 
HRHPECYVCTDCGTNLK12145.9143 HRHPECYVCTDCGTNLKlight4+537.48582145.91431322.7055 
HPECYVCTDCGTNLK01852.7542 HPECYVCTDCGTNLKlight2+927.38441852.75421330.7265 
HPECYVCTDCGTNLK01852.7542 HPECYVCTDCGTNLKlight3+618.59201852.75421325.7875 
QKGHFFVEDQIYCEK11926.8934 QKGHFFVEDQIYCEKlight3+643.30511926.89341326.7266 
GHFFVEDQIYCEK01670.7399 GHFFVEDQIYCEKlight2+836.37721670.73991327.9963 
GHFFVEDQIYCEK01670.7399 GHFFVEDQIYCEKlight3+557.92061670.73991323.4820 
ERVTPPEGYEVVTVFPK11946.0149 ERVTPPEGYEVVTVFPKlight3+649.67891946.01491326.9688 
VTPPEGYEVVTVFPK01660.8712 VTPPEGYEVVTVFPKlight2+831.44291660.87121327.8483 
VTPPEGYEVVTVFPK01660.8712 VTPPEGYEVVTVFPKlight3+554.63101660.87121323.3570 
sp|O00299|CLIC1_HUMAN Chloride intracellular channel protein 1 OS=Homo sapiens GN=CLIC1 PE=1 SV=4
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
IGNCPFSQR01077.5026 IGNCPFSQRlight2+539.75861077.50261319.0978 
IGNCPFSQRLFMVLWLKGVTFNVTTVDTK23370.7570 IGNCPFSQRLFMVLWLKGVTFNVTTVDTKlight4+843.69653370.75701334.3415 
LFMVLWLK01048.6143 LFMVLWLKlight2+525.31441048.61431318.6644 
LFMVLWLK01064.6093 LFMVLWLKlight2+533.31191064.60931318.9044 
GVTFNVTTVDTK01280.6612 GVTFNVTTVDTKlight2+641.33791280.66121322.1451 
GVTFNVTTVDTK01280.6612 GVTFNVTTVDTKlight3+427.89441280.66121318.5410 
GVTFNVTTVDTKR11436.7623 GVTFNVTTVDTKRlight2+719.38841436.76231324.4867 
GVTFNVTTVDTKR11436.7623 GVTFNVTTVDTKRlight3+479.92811436.76231320.5183 
LCPGGQLPFLLYGTEVHTDTNK02459.2155 LCPGGQLPFLLYGTEVHTDTNKlight3+820.74582459.21551333.4693 
LCPGGQLPFLLYGTEVHTDTNK02459.2155 LCPGGQLPFLLYGTEVHTDTNKlight4+615.81112459.21551325.6818 
LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPK24401.2178 LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKlight4+1101.31174401.21781344.1308 
LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPK24401.2178 LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKlight5+881.25084401.21781335.7685 
IEEFLEAVLCPPR01571.8018 IEEFLEAVLCPPRlight2+786.90821571.80181326.5122 
IEEFLEAVLCPPR01571.8018 IEEFLEAVLCPPRlight3+524.94121571.80181322.2288 
IEEFLEAVLCPPRYPK11960.0128 IEEFLEAVLCPPRYPKlight2+981.01371960.01281332.3354 
IEEFLEAVLCPPRYPK11960.0128 IEEFLEAVLCPPRYPKlight3+654.34491960.01281327.1461 
IEEFLEAVLCPPRYPK11960.0128 IEEFLEAVLCPPRYPKlight4+491.01051960.01281320.9394 
LAALNPESNTAGLDIFAK01843.9680 LAALNPESNTAGLDIFAKlight2+922.99131843.96801330.5947 
LAALNPESNTAGLDIFAK01843.9680 LAALNPESNTAGLDIFAKlight3+615.66331843.96801325.6762 
NSNPALNDNLEK01327.6368 NSNPALNDNLEKlight2+664.82571327.63681322.8498 
NSNPALNDNLEKGLLK11738.9214 NSNPALNDNLEKGLLKlight2+870.46801738.92141329.0190 
ALKVLDNYLTSPLPEEVDETSAEDEGVSQR13303.5994 ALKVLDNYLTSPLPEEVDETSAEDEGVSQRlight3+1102.20713303.59941344.1649 
ALKVLDNYLTSPLPEEVDETSAEDEGVSQR13303.5994 ALKVLDNYLTSPLPEEVDETSAEDEGVSQRlight4+826.90713303.59941333.7035 
VLDNYLTSPLPEEVDETSAEDEGVSQR02991.3833 VLDNYLTSPLPEEVDETSAEDEGVSQRlight3+998.13502991.38331340.2101 
VLDNYLTSPLPEEVDETSAEDEGVSQR02991.3833 VLDNYLTSPLPEEVDETSAEDEGVSQRlight4+748.85312991.38331330.7374 
VLDNYLTSPLPEEVDETSAEDEGVSQRK13119.4782 VLDNYLTSPLPEEVDETSAEDEGVSQRKlight3+1040.83343119.47821341.8327 
VLDNYLTSPLPEEVDETSAEDEGVSQRK13119.4782 VLDNYLTSPLPEEVDETSAEDEGVSQRKlight4+780.87683119.47821331.9543 
KFLDGNELTLADCNLLPK12060.0612 KFLDGNELTLADCNLLPKlight2+1031.03792060.06121333.8361 
KFLDGNELTLADCNLLPK12060.0612 KFLDGNELTLADCNLLPKlight3+687.69442060.06121328.4134 
FLDGNELTLADCNLLPK01931.9663 FLDGNELTLADCNLLPKlight2+966.99041931.96631331.9147 
FLDGNELTLADCNLLPK01931.9663 FLDGNELTLADCNLLPKlight3+644.99601931.96631326.7908 
LHIVQVVCK01094.6270 LHIVQVVCKlight2+548.32081094.62701319.3546 
LHIVQVVCKK11222.7220 LHIVQVVCKKlight2+612.36831222.72201321.2760 
LHIVQVVCKK11222.7220 LHIVQVVCKKlight3+408.58131222.72201317.8071 
YRGFTIPEAFR11355.6986 YRGFTIPEAFRlight2+678.85661355.69861323.2707 
YRGFTIPEAFR11355.6986 YRGFTIPEAFRlight3+452.90681355.69861319.4915 
GFTIPEAFR01036.5342 GFTIPEAFRlight2+519.27441036.53421318.4832 
YLSNAYAREEFASTCPDDEEIELAYEQVAK13510.5773 YLSNAYAREEFASTCPDDEEIELAYEQVAKlight3+1171.19973510.57731346.7866 
YLSNAYAREEFASTCPDDEEIELAYEQVAK13510.5773 YLSNAYAREEFASTCPDDEEIELAYEQVAKlight4+878.65163510.57731335.6698 
YLSNAYAR0956.4716 YLSNAYARlight2+479.2431956.47161317.2823 
EEFASTCPDDEEIELAYEQVAK02572.1163 EEFASTCPDDEEIELAYEQVAKlight3+858.37942572.11631334.8994 
EEFASTCPDDEEIELAYEQVAK02572.1163 EEFASTCPDDEEIELAYEQVAKlight4+644.03632572.11631326.7544 
sp|A6NHL2|TBAL3_HUMAN Tubulin alpha chain-like 3 OS=Homo sapiens GN=TUBAL3 PE=1 SV=2
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
SLFHPEQLLSGK01354.7245 SLFHPEQLLSGKlight2+678.36951354.72451323.2561 
SLFHPEQLLSGK01354.7245 SLFHPEQLLSGKlight3+452.58211354.72451319.4791 
EDAANNYAR01022.4417 EDAANNYARlight2+512.22811022.44171318.2718 
KLAEQCGGLQGFLIFRSFGGGTGSGFTSLLMER23520.7595 KLAEQCGGLQGFLIFRSFGGGTGSGFTSLLMERlight4+881.19723520.75951335.7665 
SFGGGTGSGFTSLLMER01702.7985 SFGGGTGSGFTSLLMERlight2+852.40651702.79851328.4772 
SFGGGTGSGFTSLLMER01702.7985 SFGGGTGSGFTSLLMERlight3+568.60681702.79851323.8881 
SFGGGTGSGFTSLLMER01718.7934 SFGGGTGSGFTSLLMERlight2+860.40401718.79341328.7171 
FEGPLNVDLIEFQTNLVPYPR02460.2689 FEGPLNVDLIEFQTNLVPYPRlight3+821.09692460.26891333.4827 
YMACCLLYR01248.5454 YMACCLLYRlight2+625.28001248.54541321.6634 
YMACCLLYR01248.5454 YMACCLLYRlight3+417.18911248.54541318.1342 
YMACCLLYR01264.5403 YMACCLLYRlight2+633.27741264.54031321.9033 
YMACCLLYRGDVVPK11843.8783 YMACCLLYRGDVVPKlight3+615.63341843.87831325.6751 
YMACCLLYRGDVVPK11859.8732 YMACCLLYRGDVVPKlight3+620.96501859.87321325.8777 
LDHKFDLMYAK11379.6908 LDHKFDLMYAKlight2+690.85271379.69081323.6306 
LDHKFDLMYAK11379.6908 LDHKFDLMYAKlight3+460.90421379.69081319.7954 
LDHKFDLMYAK11395.6857 LDHKFDLMYAKlight2+698.85011395.68571323.8705 
LDHKFDLMYAK11395.6857 LDHKFDLMYAKlight3+466.23581395.68571319.9980 
LDHKFDLMYAKR21535.7919 LDHKFDLMYAKRlight2+768.90321535.79191325.9721 
LDHKFDLMYAKR21535.7919 LDHKFDLMYAKRlight3+512.93791535.79191321.7726 
FDLMYAK0886.4259 FDLMYAKlight2+444.2202886.42591316.2316 
FDLMYAK0902.4208 FDLMYAKlight2+452.2177902.42081316.4715 
sp|A6NIZ1|RP1BL_HUMAN Ras-related protein Rap-1b-like protein OS=Homo sapiens PE=2 SV=1
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
SALTVQFVQGIFVEK01664.9138 SALTVQFVQGIFVEKlight2+833.46421664.91381327.9089 
SALTVQFVQGIFVEK01664.9138 SALTVQFVQGIFVEKlight3+555.97851664.91381323.4082 
YDPTIEDSYR01257.5513 YDPTIEDSYRlight2+629.78291257.55131321.7985 
QVEVDAQQCMLEILDTAGTEQFTAMR02999.3675 QVEVDAQQCMLEILDTAGTEQFTAMRlight3+1000.79642999.36751340.3113 
QVEVDAQQCMLEILDTAGTEQFTAMR02983.3725 QVEVDAQQCMLEILDTAGTEQFTAMRlight3+995.46482983.37251340.1087 
NGQGFALVYSITAQSTFNDLQDLR02657.3085 NGQGFALVYSITAQSTFNDLQDLRlight3+886.77682657.30851335.9785 
NGQGFALVYSITAQSTFNDLQDLREQILR13296.6790 NGQGFALVYSITAQSTFNDLQDLREQILRlight4+825.17703296.67901333.6377 
VKDTDDVPMILVGNKCDLEDER22560.2149 VKDTDDVPMILVGNKCDLEDERlight4+641.06102560.21491326.6413 
VKDTDDVPMILVGNK11642.8600 VKDTDDVPMILVGNKlight2+822.43731642.86001327.5781 
VKDTDDVPMILVGNK11642.8600 VKDTDDVPMILVGNKlight3+548.62731642.86001323.1288 
VKDTDDVPMILVGNK11658.8549 VKDTDDVPMILVGNKlight2+830.43471658.85491327.8180 
VKDTDDVPMILVGNK11658.8549 VKDTDDVPMILVGNKlight3+553.95891658.85491323.3314 
DTDDVPMILVGNK01431.6915 DTDDVPMILVGNKlight2+716.85301431.69151324.4106 
DTDDVPMILVGNK01415.6966 DTDDVPMILVGNKlight2+708.85561415.69661324.1707 
CDLEDERVVGK11318.6187 CDLEDERVVGKlight2+660.31661318.61871322.7145 
CDLEDERVVGK11318.6187 CDLEDERVVGKlight3+440.54681318.61871319.0218 
CDLEDER0935.3655 CDLEDERlight2+468.6900935.36551316.9657 
EQGQNLAR0914.4570 EQGQNLARlight2+458.2358914.45701316.6521 
QWNNCAFLESSAK01553.6933 QWNNCAFLESSAKlight2+777.85391553.69331326.2406 
QWNNCAFLESSAK01553.6933 QWNNCAFLESSAKlight3+518.90501553.69331321.9994 
SKINVNEIFYDLVRQINR22220.2015 SKINVNEIFYDLVRQINRlight3+741.07442220.20151330.4418 
SKINVNEIFYDLVRQINR22220.2015 SKINVNEIFYDLVRQINRlight4+556.05772220.20151323.4112 
SKINVNEIFYDLVR11708.9148 SKINVNEIFYDLVRlight2+855.46471708.91481328.5689 
SKINVNEIFYDLVR11708.9148 SKINVNEIFYDLVRlight3+570.64551708.91481323.9655 
INVNEIFYDLVR01493.7878 INVNEIFYDLVRlight2+747.90121493.78781325.3420 
INVNEIFYDLVR01493.7878 INVNEIFYDLVRlight3+498.93661493.78781321.2406 
sp|A8MWD9|RUXGL_HUMAN Putative small nuclear ribonucleoprotein G-like protein 15 OS=Homo sapiens GN=SNRPGP15 PE=5 SV=2
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
HVQGILR0821.4872 HVQGILRlight2+411.7509821.48721315.2575 
GNSIIMLEALER01344.7071 GNSIIMLEALERlight2+673.36081344.70711323.1058 
GNSIIMLEALER01360.7021 GNSIIMLEALERlight2+681.35831360.70211323.3457 
GNSIIMLEALERV11443.7756 GNSIIMLEALERVlight2+722.89511443.77561324.5919 
GNSIIMLEALERV11459.7705 GNSIIMLEALERVlight2+730.89251459.77051324.8318 
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
TLGYDESK0911.4236 TLGYDESKlight2+456.7191911.42361316.6066 
sp|O00148|DX39A_HUMAN ATP-dependent RNA helicase DDX39A OS=Homo sapiens GN=DDX39A PE=1 SV=2
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
GSYVSIHSSGFR01295.6258 GSYVSIHSSGFRlight2+648.82021295.62581322.3696 
GSYVSIHSSGFR01295.6258 GSYVSIHSSGFRlight3+432.88261295.62581318.7305 
GSYVSIHSSGFRDFLLKPELLR12520.3489 GSYVSIHSSGFRDFLLKPELLRlight3+841.12362520.34891334.2437 
GSYVSIHSSGFRDFLLKPELLR12520.3489 GSYVSIHSSGFRDFLLKPELLRlight4+631.09452520.34891326.2626 
GSYVSIHSSGFRDFLLKPELLR12520.3489 GSYVSIHSSGFRDFLLKPELLRlight5+505.07712520.34891321.4739 
DFLLKPELLR01242.7336 DFLLKPELLRlight2+622.37411242.73361321.5762 
DFLLKPELLR01242.7336 DFLLKPELLRlight3+415.25181242.73361318.0606 
AIVDCGFEHPSEVQHECIPQAILGMDVLCQAK03650.6990 AIVDCGFEHPSEVQHECIPQAILGMDVLCQAKlight4+913.68203650.69901337.0009 
AIVDCGFEHPSEVQHECIPQAILGMDVLCQAK03650.6990 AIVDCGFEHPSEVQHECIPQAILGMDVLCQAKlight5+731.14713650.69901330.0646 
AIVDCGFEHPSEVQHECIPQAILGMDVLCQAK03666.6939 AIVDCGFEHPSEVQHECIPQAILGMDVLCQAKlight4+917.68073666.69391337.1529 
ELAFQISK0934.5124 ELAFQISKlight2+468.2635934.51241316.9529 
ELAFQISKEYER11511.7620 ELAFQISKEYERlight2+756.88831511.76201325.6116 
ELAFQISKEYER11511.7620 ELAFQISKEYERlight3+504.92791511.76201321.4683 
VSVFFGGLSIKK11280.7493 VSVFFGGLSIKKlight3+427.92371280.74931118.5421 
VSVFFGGLSIKKDEEVLK21994.1088 VSVFFGGLSIKKDEEVLKlight3+665.71021994.10881327.5780 
VSVFFGGLSIKKDEEVLK21994.1088 VSVFFGGLSIKKDEEVLKlight4+499.53451994.10881321.2633 
VSVFFGGLSIK01152.6543 VSVFFGGLSIKlight2+577.33441152.65431320.2250 
KDEEVLK1859.4651 KDEEVLKlight2+430.7398859.46511315.8272 
KDEEVLKK2987.5601 KDEEVLKKlight2+494.7873987.56011317.7486 
KNCPHVVVGTPGR11419.7405 KNCPHVVVGTPGRlight3+474.25411419.74051320.3027 
NCPHVVVGTPGR01291.6455 NCPHVVVGTPGRlight2+646.83001291.64551322.3099 
NCPHVVVGTPGR01291.6455 NCPHVVVGTPGRlight3+431.55581291.64551318.6801 
HFVLDECDKMLEQLDMR12177.9908 HFVLDECDKMLEQLDMRlight3+727.00422177.99081329.9072 
HFVLDECDK01161.5125 HFVLDECDKlight2+581.76351161.51251320.3579 
MLEQLDMR01034.4889 MLEQLDMRlight2+518.25171034.48891318.4526 
MLEQLDMR01050.4838 MLEQLDMRlight2+526.24921050.48381318.6925 
MLEQLDMR01050.4838 MLEQLDMRlight2+526.24921050.48381318.6925 
RDVQEIFR11061.5618 RDVQEIFRlight2+531.78821061.56181318.8586 
DVQEIFR0905.4607 DVQEIFRlight2+453.7376905.46071316.5171 
QCMMFSATLSK01318.5720 QCMMFSATLSKlight2+660.29331318.57201322.7138 
QCMMFSATLSK01318.5720 QCMMFSATLSKlight2+660.29331318.57201322.7138 
QCMMFSATLSK01302.5771 QCMMFSATLSKlight2+652.29581302.57711322.4739 
KFMQDPMEVFVDDETKLTLHGLQQYYVK23401.6676 KFMQDPMEVFVDDETKLTLHGLQQYYVKlight4+851.42423401.66761334.6351 
KFMQDPMEVFVDDETKLTLHGLQQYYVK23401.6676 KFMQDPMEVFVDDETKLTLHGLQQYYVKlight5+681.34083401.66761328.1719 
FMQDPMEVFVDDETK01829.7852 FMQDPMEVFVDDETKlight2+915.89991829.78521330.3820 
FMQDPMEVFVDDETK01829.7852 FMQDPMEVFVDDETKlight3+610.93571829.78521325.4966 
FMQDPMEVFVDDETKLTLHGLQQYYVK13273.5726 FMQDPMEVFVDDETKLTLHGLQQYYVKlight4+819.40043273.57261333.4182 
LTLHGLQQYYVK01461.7980 LTLHGLQQYYVKlight2+731.90631461.79801324.8622 
LTLHGLQQYYVK01461.7980 LTLHGLQQYYVKlight3+488.27331461.79801320.8354 
CMALAQLLVEQNFPAIAIHR02310.1977 CMALAQLLVEQNFPAIAIHRlight2+1156.10612310.19771337.5882 
CMALAQLLVEQNFPAIAIHR02310.1977 CMALAQLLVEQNFPAIAIHRlight3+771.07322310.19771331.5818 
CMALAQLLVEQNFPAIAIHR02310.1977 CMALAQLLVEQNFPAIAIHRlight4+578.55672310.19771324.2662 
CMALAQLLVEQNFPAIAIHR02294.2028 CMALAQLLVEQNFPAIAIHRlight2+1148.10872294.20281337.3483 
CMALAQLLVEQNFPAIAIHR02294.2028 CMALAQLLVEQNFPAIAIHRlight3+765.74152294.20281331.3792 
CMALAQLLVEQNFPAIAIHR02294.2028 CMALAQLLVEQNFPAIAIHRlight4+574.55802294.20281324.1142 
RILVATNLFGR11258.7510 RILVATNLFGRlight2+630.38281258.75101321.8165 
ILVATNLFGR01102.6499 ILVATNLFGRlight2+552.33221102.64991319.4750 
VNIVFNYDMPEDSDTYLHR02327.0528 VNIVFNYDMPEDSDTYLHRlight2+1164.53372327.05281337.8410 
VNIVFNYDMPEDSDTYLHR02327.0528 VNIVFNYDMPEDSDTYLHRlight3+776.69162327.05281331.7953 
VNIVFNYDMPEDSDTYLHR02343.0478 VNIVFNYDMPEDSDTYLHRlight3+782.02322343.04781331.9979 
GLAITFVSDENDAK01478.7253 GLAITFVSDENDAKlight2+740.36991478.72531325.1161 
GLAITFVSDENDAK01478.7253 GLAITFVSDENDAKlight3+493.91571478.72531321.0498 
ILNDVQDR0971.5036 ILNDVQDRlight2+486.7591971.50361317.5078 
FEVNVAELPEEIDISTYIEQSR02580.2595 FEVNVAELPEEIDISTYIEQSRlight3+861.09382580.25951335.0026 
sp|O00154|BACH_HUMAN Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens GN=ACOT7 PE=1 SV=3
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
ADLPPCGACITGR01386.6384 ADLPPCGACITGRlight2+694.32651386.63841323.7348 
IMRPDDANVAGNVHGGTILK02077.0739 IMRPDDANVAGNVHGGTILKlight3+693.36522077.07391328.6289 
IMRPDDANVAGNVHGGTILK02077.0739 IMRPDDANVAGNVHGGTILKlight4+520.27572077.07391322.0515 
IMRPDDANVAGNVHGGTILK02093.0688 IMRPDDANVAGNVHGGTILKlight3+698.69692093.06881328.8315 
IMRPDDANVAGNVHGGTILK02093.0688 IMRPDDANVAGNVHGGTILKlight4+524.27452093.06881322.2034 
MIEEAGAIISTR01289.6649 MIEEAGAIISTRlight2+645.83971289.66491322.2802 
MIEEAGAIISTR01289.6649 MIEEAGAIISTRlight3+430.89561289.66491318.6550 
MIEEAGAIISTR01305.6599 MIEEAGAIISTRlight2+653.83721305.65991322.5201 
TDFLSPMCIGEVAHVSAEITYTSK02655.2560 TDFLSPMCIGEVAHVSAEITYTSKlight3+886.09262655.25601335.9525 
HSVEVQVNVMSENILTGAK02070.0416 HSVEVQVNVMSENILTGAKlight2+1036.02812070.04161333.9858 
HSVEVQVNVMSENILTGAK02070.0416 HSVEVQVNVMSENILTGAKlight3+691.02112070.04161328.5398 
HSVEVQVNVMSENILTGAK02054.0466 HSVEVQVNVMSENILTGAKlight2+1028.03062054.04661333.7459 
HSVEVQVNVMSENILTGAK02054.0466 HSVEVQVNVMSENILTGAKlight3+685.68952054.04661328.3372 
ATLWYVPLSLK01289.7384 ATLWYVPLSLKlight2+645.87651289.73841322.2813 
NVDKVLEVPPVVYSR11712.9461 NVDKVLEVPPVVYSRlight3+571.98931712.94611324.0166 
VLEVPPVVYSR01256.7129 VLEVPPVVYSRlight2+629.36371256.71291321.7859 
VLEVPPVVYSR01256.7129 VLEVPPVVYSRlight3+419.91161256.71291318.2376 
NGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMK04800.3640 NGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKlight5+961.08014800.36401338.8020 
NGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMK04800.3640 NGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKlight6+801.06794800.36401332.7216 
LMDEVAGIVAAR01259.6544 LMDEVAGIVAARlight2+630.83451259.65441321.8300 
LMDEVAGIVAAR01243.6595 LMDEVAGIVAARlight2+622.83701243.65951321.5901 
LMDEVAGIVAAR01243.6595 LMDEVAGIVAARlight3+415.56041243.65951318.0723 
TNIVTASVDAINFHDKIR12013.0643 TNIVTASVDAINFHDKIRlight2+1007.53942013.06431333.1312 
TNIVTASVDAINFHDKIR12013.0643 TNIVTASVDAINFHDKIRlight3+672.02872013.06431327.8181 
TNIVTASVDAINFHDKIR12013.0643 TNIVTASVDAINFHDKIRlight4+504.27342013.06431321.4434 
TNIVTASVDAINFHDK01743.8792 TNIVTASVDAINFHDKlight2+872.94691743.87921329.0934 
TNIVTASVDAINFHDK01743.8792 TNIVTASVDAINFHDKlight3+582.30031743.87921324.4084 
KGCVITISGR11089.5965 KGCVITISGRlight2+545.80551089.59651319.2792 
GCVITISGR0961.5015 GCVITISGRlight2+481.7580961.50151317.3577 
MTFTSNK0827.3847 MTFTSNKlight2+414.6996827.38471015.3460 
SMEIEVLVDADPVVDSSQK02059.9984 SMEIEVLVDADPVVDSSQKlight2+1031.00652059.99841333.8352 
SMEIEVLVDADPVVDSSQKR12216.0995 SMEIEVLVDADPVVDSSQKRlight2+1109.05702216.09951336.1767 
SMEIEVLVDADPVVDSSQKR12216.0995 SMEIEVLVDADPVVDSSQKRlight3+739.70712216.09951330.3899 
SMEIEVLVDADPVVDSSQKR12232.0944 SMEIEVLVDADPVVDSSQKRlight3+745.03872232.09441330.5925 
AASAFFTYVSLSQEGR01732.8420 AASAFFTYVSLSQEGRlight2+867.42831732.84201328.9278 
AASAFFTYVSLSQEGR01732.8420 AASAFFTYVSLSQEGRlight3+578.62131732.84201324.2686 
SLPVPQLVPETEDEKKR21964.0579 SLPVPQLVPETEDEKKRlight3+655.69321964.05791327.1973 
SLPVPQLVPETEDEKKR21964.0579 SLPVPQLVPETEDEKKRlight4+492.02171964.05791320.9778 
SLPVPQLVPETEDEK01679.8618 SLPVPQLVPETEDEKlight2+840.93821679.86181328.1331 
SLPVPQLVPETEDEK01679.8618 SLPVPQLVPETEDEKlight3+560.96121679.86181323.5975 
SLPVPQLVPETEDEKK11807.9567 SLPVPQLVPETEDEKKlight3+603.65951807.95671325.2201 
RQGHAEPQP11018.4944 RQGHAEPQPlight2+510.25451018.49441318.2126 
sp|O00170|AIP_HUMAN AH receptor-interacting protein OS=Homo sapiens GN=AIP PE=1 SV=2
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
RVIQEGRGELPDFQDGTK22044.0338 RVIQEGRGELPDFQDGTKlight3+682.35192044.03381328.2104 
RVIQEGRGELPDFQDGTK22044.0338 RVIQEGRGELPDFQDGTKlight4+512.01572044.03381321.7376 
GELPDFQDGTK01205.5564 GELPDFQDGTKlight2+603.78551205.55641321.0186 
TLHSDDEGTVLDDSR01658.7384 TLHSDDEGTVLDDSRlight2+830.37651658.73841327.8163 
TLHSDDEGTVLDDSR01658.7384 TLHSDDEGTVLDDSRlight3+553.92011658.73841323.3300 
GKPMELIIGK01084.6315 GKPMELIIGKlight2+543.32301084.63151319.2047 
FKLPVWETIVCTMR11778.9212 FKLPVWETIVCTMRlight3+593.98101778.92121324.8523 
LPVWETIVCTMR01503.7578 LPVWETIVCTMRlight2+752.88621503.75781325.4916 
LPVWETIVCTMR01503.7578 LPVWETIVCTMRlight3+502.25991503.75781321.3669 
EGEIAQFLCDIK01421.6861 EGEIAQFLCDIKlight2+711.85031421.68611324.2605 
HVVLYPLVAK01137.6910 HVVLYPLVAKlight2+569.85281137.69101320.0006 
NIAVGKDPLEGQR11395.7470 NIAVGKDPLEGQRlight2+698.88081395.74701323.8714 
NIAVGKDPLEGQR11395.7470 NIAVGKDPLEGQRlight3+466.25631395.74701319.9987 
HCCGVAQMR01117.4579 HCCGVAQMRlight2+559.73621117.45791319.6971 
EHSSLGHADLDALQQNPQPLIFHMEMLK03198.5590 EHSSLGHADLDALQQNPQPLIFHMEMLKlight3+1067.19363198.55901342.8344 
EHSSLGHADLDALQQNPQPLIFHMEMLK03198.5590 EHSSLGHADLDALQQNPQPLIFHMEMLKlight4+800.64703198.55901332.7056 
EHSSLGHADLDALQQNPQPLIFHMEMLK03198.5590 EHSSLGHADLDALQQNPQPLIFHMEMLKlight5+640.71913198.55901326.6283 
VESPGTYQQDPWAMTDEEK02209.9474 VESPGTYQQDPWAMTDEEKlight2+1105.98102209.94741336.0844 
AVPLIHQEGNR01232.6626 AVPLIHQEGNRlight2+617.33861232.66261321.4252 
AVPLIHQEGNR01232.6626 AVPLIHQEGNRlight3+411.89481232.66261317.9330 
YYDAIACLK01115.5321 YYDAIACLKlight2+558.77331115.53211319.6682 
EQPGSPEWIQLDQQITPLLLNYCQCK03157.5213 EQPGSPEWIQLDQQITPLLLNYCQCKlight3+1053.51443157.52131342.3145 
LVVEEYYEVLDHCSSILNK02309.1249 LVVEEYYEVLDHCSSILNKlight2+1155.56982309.12491337.5721 
LVVEEYYEVLDHCSSILNK02309.1249 LVVEEYYEVLDHCSSILNKlight3+770.71562309.12491331.5682 
LVVEEYYEVLDHCSSILNKYDDNVK13043.4485 LVVEEYYEVLDHCSSILNKYDDNVKlight4+761.86943043.44851331.2320 
AHAAVWNAQEAQADFAK01826.8700 AHAAVWNAQEAQADFAKlight2+914.44231826.87001330.3383 
AHAAVWNAQEAQADFAK01826.8700 AHAAVWNAQEAQADFAKlight3+609.96391826.87001325.4596 
VLELDPALAPVVSR01477.8504 VLELDPALAPVVSRlight2+739.93251477.85041325.1030 
VLELDPALAPVVSR01477.8504 VLELDPALAPVVSRlight3+493.62411477.85041321.0387