sasp_panel_atazanavir_2019-02-26_11-45-06.sky.zip

SASP_Atlas_Buck
sasp_panel_atazanavir_2019-02-26_11-45-06.sky.zip   1 version
 
376 proteins, 15,601 peptides, 23,172 precursors, 301,032 transitions  -  0 replicates  -  Skyline-daily (64-bit) 4.2.1.19004
Protein / LabelDescriptionProtein Note/Annotations 
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
ANLNALDR0885.4668 ANLNALDRlight2+443.7407885.46681316.2172 
AGFAGDDAPRAVFPSIVGRPR12155.1287 AGFAGDDAPRAVFPSIVGRPRlight4+539.78942155.12871322.7930 
AGFAGDDAPR0975.4410 AGFAGDDAPRlight2+488.7278975.44101317.5668 
AVFPSIVGR0944.5444 AVFPSIVGRlight2+473.2795944.54441317.1034 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight2+599.85641197.69821320.9007 
AVFPSIVGRPR01197.6982 AVFPSIVGRPRlight3+400.24001197.69821317.4901 
RGILTLK1799.5280 RGILTLKlight2+400.7713799.52801314.9281 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight2+758.37821514.74191325.6563 
IWHHTFYNELR01514.7419 IWHHTFYNELRlight3+505.92121514.74191321.5060 
VAPEEHPVLLTEATLNPK01957.0520 VAPEEHPVLLTEATLNPKlight3+653.35801957.05201327.1086 
RLDLAGR1799.4664 RLDLAGRlight2+400.7405799.46641314.9272 
EIVRDIKEK21128.6503 EIVRDIKEKlight2+565.33241128.65031319.8650 
LCYVALDFEQEMATVASSSSLEK02577.1979 LCYVALDFEQEMATVASSSSLEKlight3+860.07322577.19791334.9638 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight2+895.94961789.88461329.7835 
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight3+597.63551789.88461324.9911 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight3+698.69202093.05421328.8313 
SYELPDGQVITIGNERFR12093.0542 SYELPDGQVITIGNERFRlight4+524.27082093.05421322.2033 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight4+902.66293606.62261336.5822 
FRCPEALFQPCFLGMESCGIHETTFNSIMK13606.6226 FRCPEALFQPCFLGMESCGIHETTFNSIMKlight5+722.33183606.62261329.7296 
CPEALFQPCFLGMESCGIHETTFNSIMK03303.4531 CPEALFQPCFLGMESCGIHETTFNSIMKlight4+826.87063303.45311333.7021 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight2+822.90251643.79031327.5921 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight3+548.93741643.79031323.1406 
QEYDESGPSIVHRK11643.7903 QEYDESGPSIVHRKlight4+411.95491643.79031317.9353 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight2+758.85501515.69541325.6706 
QEYDESGPSIVHR01515.6954 QEYDESGPSIVHRlight3+506.23911515.69541321.5181 
sp|O00151|PDLI1_HUMAN PDZ and LIM domain protein 1 OS=Homo sapiens GN=PDLIM1 PE=1 SV=4
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight2+815.45161628.88861327.3685 
LVGGKDFEQPLAISR11628.8886 LVGGKDFEQPLAISRlight3+543.97011628.88861322.9519 
DFEQPLAISR01174.5982 DFEQPLAISRlight2+588.30641174.59821320.5542 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3+1104.86983311.58741344.2661 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03311.5874 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight4+828.90413311.58741333.7794 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight3+1110.20143327.58241344.4687 
AALANLCIGDVITAIDGENTSNMTHLEAQNR03327.5824 AALANLCIGDVITAIDGENTSNMTHLEAQNRlight4+832.90293327.58241333.9313 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight2+781.42201560.82941326.3477 
IKGCTDNLTLTVAR11560.8294 IKGCTDNLTLTVARlight3+521.28371560.82941322.0898 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight2+660.83251319.65031322.7300 
GCTDNLTLTVAR01319.6503 GCTDNLTLTVARlight3+440.89071319.65031319.0348 
SEHKVWSPLVTEEGKR21880.9745 SEHKVWSPLVTEEGKRlight3+627.99881880.97451326.1450 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight2+700.88031399.74601323.9314 
VWSPLVTEEGKR11399.7460 VWSPLVTEEGKRlight3+467.58931399.74601320.0494 
VWSPLVTEEGK01243.6449 VWSPLVTEEGKlight2+622.82971243.64491321.5899 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight2+1052.02362102.03271334.4657 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight3+701.68482102.03271328.9450 
MNLASEPQEVLHIGSAHNR02102.0327 MNLASEPQEVLHIGSAHNRlight4+526.51552102.03271322.2886 
MNLASEPQEVLHIGSAHNR02118.0276 MNLASEPQEVLHIGSAHNRlight4+530.51422118.02761322.4405 
SAMPFTASPASSTTAR01597.7406 SAMPFTASPASSTTARlight2+799.87761597.74061326.9013 
SAMPFTASPASSTTAR01581.7457 SAMPFTASPASSTTARlight2+791.88011581.74571326.6614 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight3+1034.49853100.47381341.5919 
VITNQYNNPAGLYSSENISNFNNALESK03100.4738 VITNQYNNPAGLYSSENISNFNNALESKlight4+776.12573100.47381331.7738 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight3+887.45952659.35661336.0045 
TAASGVEANSRPLDHAQPPSSLVIDK02659.3566 TAASGVEANSRPLDHAQPPSSLVIDKlight4+665.84642659.35661327.5832 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight3+1132.57413394.70051345.3188 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight4+849.68243394.70051334.5689 
TAASGVEANSRPLDHAQPPSSLVIDKESEVYK13394.7005 TAASGVEANSRPLDHAQPPSSLVIDKESEVYKlight5+679.94743394.70051328.1190 
PLDHAQPPSSLVIDK01615.8570 PLDHAQPPSSLVIDKlight3+539.62631615.85701322.7868 
QELNEPPKQSTSFLVLQEILESEEK12914.4811 QELNEPPKQSTSFLVLQEILESEEKlight3+972.50102914.48111339.2360 
QELNEPPK0953.4818 QELNEPPKlight2+477.7482953.48181317.2374 
QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFR23969.9960 QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRlight4+993.50633969.99601340.0342 
QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFR23969.9960 QELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRlight5+795.00653969.99601332.4912 
QSTSFLVLQEILESEEKGDPNKPSGFR13034.5247 QSTSFLVLQEILESEEKGDPNKPSGFRlight3+1012.51553034.52471340.7566 
QSTSFLVLQEILESEEKGDPNKPSGFR13034.5247 QSTSFLVLQEILESEEKGDPNKPSGFRlight4+759.63853034.52471331.1473 
QSTSFLVLQEILESEEKGDPNKPSGFR13034.5247 QSTSFLVLQEILESEEKGDPNKPSGFRlight5+607.91223034.52471325.3817 
QSTSFLVLQEILESEEK01979.0099 QSTSFLVLQEILESEEKlight2+990.51221979.00991332.6204 
QSTSFLVLQEILESEEK01979.0099 QSTSFLVLQEILESEEKlight3+660.67721979.00991327.3867 
VAASIGNAQK0957.5243 VAASIGNAQKlight2+479.7694957.52431317.2981 
CGTGIVGVFVK01135.6060 CGTGIVGVFVKlight2+568.81031135.60601319.9693 
HRHPECYVCTDCGTNLK12145.9143 HRHPECYVCTDCGTNLKlight3+716.31202145.91431329.5009 
HRHPECYVCTDCGTNLK12145.9143 HRHPECYVCTDCGTNLKlight4+537.48582145.91431322.7055 
HPECYVCTDCGTNLK01852.7542 HPECYVCTDCGTNLKlight2+927.38441852.75421330.7265 
HPECYVCTDCGTNLK01852.7542 HPECYVCTDCGTNLKlight3+618.59201852.75421325.7875 
QKGHFFVEDQIYCEK11926.8934 QKGHFFVEDQIYCEKlight3+643.30511926.89341326.7266 
GHFFVEDQIYCEK01670.7399 GHFFVEDQIYCEKlight2+836.37721670.73991327.9963 
GHFFVEDQIYCEK01670.7399 GHFFVEDQIYCEKlight3+557.92061670.73991323.4820 
ERVTPPEGYEVVTVFPK11946.0149 ERVTPPEGYEVVTVFPKlight3+649.67891946.01491326.9688 
VTPPEGYEVVTVFPK01660.8712 VTPPEGYEVVTVFPKlight2+831.44291660.87121327.8483 
VTPPEGYEVVTVFPK01660.8712 VTPPEGYEVVTVFPKlight3+554.63101660.87121323.3570 
sp|O00299|CLIC1_HUMAN Chloride intracellular channel protein 1 OS=Homo sapiens GN=CLIC1 PE=1 SV=4
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
IGNCPFSQR01077.5026 IGNCPFSQRlight2+539.75861077.50261319.0978 
IGNCPFSQRLFMVLWLKGVTFNVTTVDTK23370.7570 IGNCPFSQRLFMVLWLKGVTFNVTTVDTKlight4+843.69653370.75701334.3415 
LFMVLWLK01048.6143 LFMVLWLKlight2+525.31441048.61431318.6644 
LFMVLWLK01064.6093 LFMVLWLKlight2+533.31191064.60931318.9044 
GVTFNVTTVDTK01280.6612 GVTFNVTTVDTKlight2+641.33791280.66121322.1451 
GVTFNVTTVDTK01280.6612 GVTFNVTTVDTKlight3+427.89441280.66121318.5410 
GVTFNVTTVDTKR11436.7623 GVTFNVTTVDTKRlight2+719.38841436.76231324.4867 
GVTFNVTTVDTKR11436.7623 GVTFNVTTVDTKRlight3+479.92811436.76231320.5183 
LCPGGQLPFLLYGTEVHTDTNK02459.2155 LCPGGQLPFLLYGTEVHTDTNKlight3+820.74582459.21551333.4693 
LCPGGQLPFLLYGTEVHTDTNK02459.2155 LCPGGQLPFLLYGTEVHTDTNKlight4+615.81112459.21551325.6818 
LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPK24401.2178 LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKlight4+1101.31174401.21781344.1308 
LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPK24401.2178 LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKlight5+881.25084401.21781335.7685 
IEEFLEAVLCPPR01571.8018 IEEFLEAVLCPPRlight2+786.90821571.80181326.5122 
IEEFLEAVLCPPR01571.8018 IEEFLEAVLCPPRlight3+524.94121571.80181322.2288 
IEEFLEAVLCPPRYPK11960.0128 IEEFLEAVLCPPRYPKlight2+981.01371960.01281332.3354 
IEEFLEAVLCPPRYPK11960.0128 IEEFLEAVLCPPRYPKlight3+654.34491960.01281327.1461 
IEEFLEAVLCPPRYPK11960.0128 IEEFLEAVLCPPRYPKlight4+491.01051960.01281320.9394 
LAALNPESNTAGLDIFAK01843.9680 LAALNPESNTAGLDIFAKlight2+922.99131843.96801330.5947 
LAALNPESNTAGLDIFAK01843.9680 LAALNPESNTAGLDIFAKlight3+615.66331843.96801325.6762 
NSNPALNDNLEK01327.6368 NSNPALNDNLEKlight2+664.82571327.63681322.8498 
NSNPALNDNLEKGLLK11738.9214 NSNPALNDNLEKGLLKlight2+870.46801738.92141329.0190 
ALKVLDNYLTSPLPEEVDETSAEDEGVSQR13303.5994 ALKVLDNYLTSPLPEEVDETSAEDEGVSQRlight3+1102.20713303.59941344.1649 
ALKVLDNYLTSPLPEEVDETSAEDEGVSQR13303.5994 ALKVLDNYLTSPLPEEVDETSAEDEGVSQRlight4+826.90713303.59941333.7035 
VLDNYLTSPLPEEVDETSAEDEGVSQR02991.3833 VLDNYLTSPLPEEVDETSAEDEGVSQRlight3+998.13502991.38331340.2101 
VLDNYLTSPLPEEVDETSAEDEGVSQR02991.3833 VLDNYLTSPLPEEVDETSAEDEGVSQRlight4+748.85312991.38331330.7374 
VLDNYLTSPLPEEVDETSAEDEGVSQRK13119.4782 VLDNYLTSPLPEEVDETSAEDEGVSQRKlight3+1040.83343119.47821341.8327 
VLDNYLTSPLPEEVDETSAEDEGVSQRK13119.4782 VLDNYLTSPLPEEVDETSAEDEGVSQRKlight4+780.87683119.47821331.9543 
KFLDGNELTLADCNLLPK12060.0612 KFLDGNELTLADCNLLPKlight2+1031.03792060.06121333.8361 
KFLDGNELTLADCNLLPK12060.0612 KFLDGNELTLADCNLLPKlight3+687.69442060.06121328.4134 
FLDGNELTLADCNLLPK01931.9663 FLDGNELTLADCNLLPKlight2+966.99041931.96631331.9147 
FLDGNELTLADCNLLPK01931.9663 FLDGNELTLADCNLLPKlight3+644.99601931.96631326.7908 
LHIVQVVCK01094.6270 LHIVQVVCKlight2+548.32081094.62701319.3546 
LHIVQVVCKK11222.7220 LHIVQVVCKKlight2+612.36831222.72201321.2760 
LHIVQVVCKK11222.7220 LHIVQVVCKKlight3+408.58131222.72201317.8071 
YRGFTIPEAFR11355.6986 YRGFTIPEAFRlight2+678.85661355.69861323.2707 
YRGFTIPEAFR11355.6986 YRGFTIPEAFRlight3+452.90681355.69861319.4915 
GFTIPEAFR01036.5342 GFTIPEAFRlight2+519.27441036.53421318.4832 
YLSNAYAREEFASTCPDDEEIELAYEQVAK13510.5773 YLSNAYAREEFASTCPDDEEIELAYEQVAKlight3+1171.19973510.57731346.7866 
YLSNAYAREEFASTCPDDEEIELAYEQVAK13510.5773 YLSNAYAREEFASTCPDDEEIELAYEQVAKlight4+878.65163510.57731335.6698 
YLSNAYAR0956.4716 YLSNAYARlight2+479.2431956.47161317.2823 
EEFASTCPDDEEIELAYEQVAK02572.1163 EEFASTCPDDEEIELAYEQVAKlight3+858.37942572.11631334.8994 
EEFASTCPDDEEIELAYEQVAK02572.1163 EEFASTCPDDEEIELAYEQVAKlight4+644.03632572.11631326.7544 
sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens GN=IPO5 PE=1 SV=4
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
KQAEETYENIPGQSK11720.8268 KQAEETYENIPGQSKlight2+861.42071720.82681328.7476 
KQAEETYENIPGQSK11720.8268 KQAEETYENIPGQSKlight3+574.61621720.82681324.1164 
QAEETYENIPGQSK01592.7318 QAEETYENIPGQSKlight2+797.37321592.73181326.8262 
QAEETYENIPGQSK01592.7318 QAEETYENIPGQSKlight3+531.91791592.73181322.4939 
ITFLLQAIR01073.6597 ITFLLQAIRlight2+537.83711073.65971319.0401 
NTTAAEEAR0961.4465 NTTAAEEARlight2+481.7305961.44651317.3569 
QMAAVLLR0900.5215 QMAAVLLRlight2+451.2680900.52151316.4430 
RLLSSAFDEVYPALPSDVQTAIK12519.3272 RLLSSAFDEVYPALPSDVQTAIKlight3+840.78302519.32721334.2308 
LLSSAFDEVYPALPSDVQTAIK02363.2260 LLSSAFDEVYPALPSDVQTAIKlight2+1182.62032363.22601338.3836 
LLSSAFDEVYPALPSDVQTAIK02363.2260 LLSSAFDEVYPALPSDVQTAIKlight3+788.74932363.22601332.2535 
SELLMIIQMETQSSMR01895.9155 SELLMIIQMETQSSMRlight3+632.97911895.91551326.3342 
KVCDIAAELAR11244.6547 KVCDIAAELARlight2+623.33461244.65471321.6050 
KVCDIAAELAR11244.6547 KVCDIAAELARlight3+415.89221244.65471318.0849 
VCDIAAELAR01116.5597 VCDIAAELARlight2+559.28711116.55971319.6836 
NLIDEDGNNQWPEGLK01840.8592 NLIDEDGNNQWPEGLKlight2+921.43691840.85921330.5481 
NLIDEDGNNQWPEGLK01840.8592 NLIDEDGNNQWPEGLKlight3+614.62701840.85921325.6368 
FLFDSVSSQNVGLR01567.7995 FLFDSVSSQNVGLRlight2+784.90701567.79951326.4522 
FLFDSVSSQNVGLR01567.7995 FLFDSVSSQNVGLRlight3+523.60711567.79951322.1781 
EAALHIFWNFPGIFGNQQQHYLDVIK03084.5610 EAALHIFWNFPGIFGNQQQHYLDVIKlight3+1029.19433084.56101341.3904 
EAALHIFWNFPGIFGNQQQHYLDVIK03084.5610 EAALHIFWNFPGIFGNQQQHYLDVIKlight4+772.14753084.56101331.6226 
RMLVQCMQDQEHPSIR12026.9499 RMLVQCMQDQEHPSIRlight4+507.74482026.94991321.5753 
MLVQCMQDQEHPSIR01870.8488 MLVQCMQDQEHPSIRlight2+936.43171870.84881330.9979 
MLVQCMQDQEHPSIR01870.8488 MLVQCMQDQEHPSIRlight3+624.62351870.84881326.0167 
ATAAFILANEHNVALFK01828.9836 ATAAFILANEHNVALFKlight2+915.49911828.98361330.3700 
ATAAFILANEHNVALFK01828.9836 ATAAFILANEHNVALFKlight3+610.66851828.98361325.4864 
ATAAFILANEHNVALFK01828.9836 ATAAFILANEHNVALFKlight4+458.25321828.98361319.6946 
HFADLLPGFLQAVNDSCYQNDDSVLK02965.3916 HFADLLPGFLQAVNDSCYQNDDSVLKlight3+989.47112965.39161339.8809 
HFADLLPGFLQAVNDSCYQNDDSVLK02965.3916 HFADLLPGFLQAVNDSCYQNDDSVLKlight4+742.35522965.39161330.4905 
SLVEIADTVPK01170.6496 SLVEIADTVPKlight2+586.33211170.64961320.4950 
YLRPHLEATLQLSLK01781.0200 YLRPHLEATLQLSLKlight2+891.51731781.02001329.6505 
YLRPHLEATLQLSLK01781.0200 YLRPHLEATLQLSLKlight3+594.68061781.02001324.8789 
LCGDTSLNNMQR01407.6235 LCGDTSLNNMQRlight2+704.81901407.62351324.0496 
LCGDTSLNNMQR01423.6184 LCGDTSLNNMQRlight2+712.81651423.61841324.2895 
LVLPMIKEHIMQMLQNPDWK12463.2841 LVLPMIKEHIMQMLQNPDWKlight3+822.10202463.28411333.5209 
LVLPMIKEHIMQMLQNPDWK12463.2841 LVLPMIKEHIMQMLQNPDWKlight4+616.82832463.28411325.7205 
LVLPMIK0812.5194 LVLPMIKlight2+407.2670812.51941315.1230 
EHIMQMLQNPDWK01684.7701 EHIMQMLQNPDWKlight2+843.39231684.77011328.2068 
EHIMQMLQNPDWK01684.7701 EHIMQMLQNPDWKlight2+843.39231684.77011328.2068 
EHIMQMLQNPDWK01684.7701 EHIMQMLQNPDWKlight3+562.59731684.77011323.6597 
EHIMQMLQNPDWK01668.7752 EHIMQMLQNPDWKlight2+835.39491668.77521327.9668 
EHIMQMLQNPDWK01668.7752 EHIMQMLQNPDWKlight3+557.26571668.77521323.4571 
YAACNAVGQMATDFAPGFQK02161.9561 YAACNAVGQMATDFAPGFQKlight3+721.65932161.95611329.7041 
YAACNAVGQMATDFAPGFQK02145.9612 YAACNAVGQMATDFAPGFQKlight2+1073.98792145.96121335.1246 
YAACNAVGQMATDFAPGFQK02145.9612 YAACNAVGQMATDFAPGFQKlight3+716.32772145.96121329.5015 
VIAALLQTMEDQGNQR01785.9043 VIAALLQTMEDQGNQRlight2+893.95941785.90431329.7238 
VIAALLQTMEDQGNQR01785.9043 VIAALLQTMEDQGNQRlight3+596.30871785.90431324.9407 
VIAALLQTMEDQGNQR01801.8992 VIAALLQTMEDQGNQRlight2+901.95691801.89921329.9637 
VQAHAAAALINFTEDCPK01954.9571 VQAHAAAALINFTEDCPKlight2+978.48581954.95711332.2596 
VQAHAAAALINFTEDCPK01954.9571 VQAHAAAALINFTEDCPKlight3+652.65961954.95711327.0821 
VQAHAAAALINFTEDCPK01954.9571 VQAHAAAALINFTEDCPKlight4+489.74661954.95711320.8914 
SLLIPYLDNLVK01386.8123 SLLIPYLDNLVKlight2+694.41341386.81231323.7374 
SLLIPYLDNLVK01386.8123 SLLIPYLDNLVKlight3+463.27801386.81231319.8856 
SLLIPYLDNLVKHLHSIMVLK12445.4182 SLLIPYLDNLVKHLHSIMVLKlight4+612.36182445.41821325.5507 
LQELIQK0870.5175 LQELIQKlight2+436.2660870.51751315.9930 
LVLEQVVTSIASVADTAEEK02101.1154 LVLEQVVTSIASVADTAEEKlight2+1051.56502101.11541334.4520 
LVLEQVVTSIASVADTAEEK02101.1154 LVLEQVVTSIASVADTAEEKlight3+701.37912101.11541328.9334 
FVPYYDLFMPSLK01618.8105 FVPYYDLFMPSLKlight2+810.41251618.81051327.2174 
FVPYYDLFMPSLK01618.8105 FVPYYDLFMPSLKlight3+540.61081618.81051322.8242 
FVPYYDLFMPSLK01634.8055 FVPYYDLFMPSLKlight2+818.41001634.80551327.4573 
HIVENAVQKELR11434.7943 HIVENAVQKELRlight3+479.27201434.79431320.4933 
HIVENAVQK01036.5665 HIVENAVQKlight2+519.29051036.56651318.4837 
TIECISLIGLAVGK01472.8273 TIECISLIGLAVGKlight2+737.42091472.82731325.0276 
TIECISLIGLAVGK01472.8273 TIECISLIGLAVGKlight3+491.94971472.82731320.9751 
FMQDASDVMQLLLK01637.8157 FMQDASDVMQLLLKlight2+819.91511637.81571327.5025 
FMQDASDVMQLLLK01637.8157 FMQDASDVMQLLLKlight3+546.94581637.81571323.0649 
FMQDASDVMQLLLK01653.8106 FMQDASDVMQLLLKlight2+827.91261653.81061327.7424 
FMQDASDVMQLLLK01653.8106 FMQDASDVMQLLLKlight3+552.27751653.81061323.2675 
TQTDFNDMEDDDPQISYMISAWAR02848.1956 TQTDFNDMEDDDPQISYMISAWARlight3+950.40582848.19561338.3964 
ILGKEFQQYLPVVMGPLMK12190.1945 ILGKEFQQYLPVVMGPLMKlight3+731.07212190.19451330.0617 
EFQQYLPVVMGPLMK01778.9099 EFQQYLPVVMGPLMKlight2+890.46221778.90991329.6189 
EFQQYLPVVMGPLMK01778.9099 EFQQYLPVVMGPLMKlight3+593.97731778.90991324.8521 
EFQQYLPVVMGPLMK01794.9048 EFQQYLPVVMGPLMKlight2+898.45971794.90481329.8588 
EFQQYLPVVMGPLMK01794.9048 EFQQYLPVVMGPLMKlight2+898.45971794.90481329.8588 
TASIKPEVALLDTQDMENMSDDDGWEFVNLGDQQSFGIK04342.9886 TASIKPEVALLDTQDMENMSDDDGWEFVNLGDQQSFGIKlight4+1086.75444342.98861343.5777 
STACQMLVCYAK01430.6356 STACQMLVCYAKlight2+716.32511430.63561324.3948 
STACQMLVCYAK01430.6356 STACQMLVCYAKlight3+477.88581430.63561320.4407 
STACQMLVCYAK01446.6305 STACQMLVCYAKlight2+724.32251446.63051324.6347 
ELKEGFVEYTEQVVK11796.9196 ELKEGFVEYTEQVVKlight2+899.46711796.91961329.8890 
ELKEGFVEYTEQVVK11796.9196 ELKEGFVEYTEQVVKlight3+599.98051796.91961325.0803 
EGFVEYTEQVVK01426.6980 EGFVEYTEQVVKlight2+714.35631426.69801324.3357 
LMVPLLK0828.5143 LMVPLLKlight2+415.2644828.51431315.3629 
LMVPLLK0812.5194 LMVPLLKlight2+407.2670812.51941315.1230 
FYFHDGVR01039.4876 FYFHDGVRlight2+520.75111039.48761318.5275 
VAAAESMPLLLECAR01645.8168 VAAAESMPLLLECARlight2+823.91571645.81681327.6225 
VAAAESMPLLLECAR01629.8218 VAAAESMPLLLECARlight2+815.91821629.82181327.3825 
VAAAESMPLLLECAR01629.8218 VAAAESMPLLLECARlight3+544.28121629.82181322.9637 
VRGPEYLTQMWHFMCDALIK12510.1909 VRGPEYLTQMWHFMCDALIKlight4+628.55502510.19091326.1661 
VRGPEYLTQMWHFMCDALIK12494.1960 VRGPEYLTQMWHFMCDALIKlight3+832.40592494.19601333.9124 
VRGPEYLTQMWHFMCDALIK12494.1960 VRGPEYLTQMWHFMCDALIKlight4+624.55632494.19601326.0141 
VRGPEYLTQMWHFMCDALIK12510.1909 VRGPEYLTQMWHFMCDALIKlight4+628.55502510.19091326.1661 
GPEYLTQMWHFMCDALIK02239.0264 GPEYLTQMWHFMCDALIKlight3+747.34942239.02641330.6803 
AIGTEPDSDVLSEIMHSFAK02146.0252 AIGTEPDSDVLSEIMHSFAKlight2+1074.01992146.02521335.1256 
AIGTEPDSDVLSEIMHSFAK02146.0252 AIGTEPDSDVLSEIMHSFAKlight3+716.34902146.02521329.5023 
CIEVMGDGCLNNEHFEELGGILK02633.1924 CIEVMGDGCLNNEHFEELGGILKlight3+878.73812633.19241335.6730 
CIEVMGDGCLNNEHFEELGGILK02649.1873 CIEVMGDGCLNNEHFEELGGILKlight3+884.06972649.18731335.8756 
AKLEEHFKNQELR21640.8635 AKLEEHFKNQELRlight3+547.96181640.86351323.1035 
AKLEEHFKNQELR21640.8635 AKLEEHFKNQELRlight4+411.22311640.86351317.9075 
RQDEDYDEQVEESLQDEDDNDVYILTK13302.4223 RQDEDYDEQVEESLQDEDDNDVYILTKlight3+1101.81473302.42231344.1500 
RQDEDYDEQVEESLQDEDDNDVYILTK13302.4223 RQDEDYDEQVEESLQDEDDNDVYILTKlight4+826.61283302.42231233.6923 
VSDILHSIFSSYK01494.7718 VSDILHSIFSSYKlight2+748.39321494.77181325.3568 
VSDILHSIFSSYK01494.7718 VSDILHSIFSSYKlight3+499.26461494.77181321.2531 
VSDILHSIFSSYKEK11751.9094 VSDILHSIFSSYKEKlight3+584.97711751.90941324.5101 
VSDILHSIFSSYKEK11751.9094 VSDILHSIFSSYKEKlight4+438.98461751.90941318.9624 
QWGLCIFDDVIEHCSPASFK02408.0929 QWGLCIFDDVIEHCSPASFKlight3+803.70492408.09291332.8218 
YAEYFLRPMLQYVCDNSPEVR02665.2305 YAEYFLRPMLQYVCDNSPEVRlight3+889.41742665.23051336.0789 
YAEYFLRPMLQYVCDNSPEVR02649.2356 YAEYFLRPMLQYVCDNSPEVRlight3+884.08582649.23561335.8763 
YAEYFLRPMLQYVCDNSPEVR02649.2356 YAEYFLRPMLQYVCDNSPEVRlight4+663.31622649.23561327.4870 
PMLQYVCDNSPEVR01706.7756 PMLQYVCDNSPEVRlight2+854.39511706.77561328.5369 
QAAAYGLGVMAQYGGDNYRPFCTEALPLLVR03400.6697 QAAAYGLGVMAQYGGDNYRPFCTEALPLLVRlight3+1134.56383400.66971345.3944 
QAAAYGLGVMAQYGGDNYRPFCTEALPLLVR03400.6697 QAAAYGLGVMAQYGGDNYRPFCTEALPLLVRlight4+851.17473400.66971334.6256 
VIQSADSK0846.4447 VIQSADSKlight2+424.2296846.44471315.6319 
TKENVNATENCISAVGK11833.8891 TKENVNATENCISAVGKlight2+917.95181833.88911330.4436 
TKENVNATENCISAVGK11833.8891 TKENVNATENCISAVGKlight3+612.30361833.88911325.5485 
ENVNATENCISAVGK01604.7464 ENVNATENCISAVGKlight2+803.38051604.74641327.0064 
FKPDCVNVEEVLPHWLSWLPLHEDK03086.5324 FKPDCVNVEEVLPHWLSWLPLHEDKlight4+772.64043086.53241331.6413 
FKPDCVNVEEVLPHWLSWLPLHEDK03086.5324 FKPDCVNVEEVLPHWLSWLPLHEDKlight5+618.31383086.53241325.7769 
EEAVQTFNYLCDLIESNHPIVLGPNNTNLPK03538.7402 EEAVQTFNYLCDLIESNHPIVLGPNNTNLPKlight3+1180.58743538.74021347.1433 
EEAVQTFNYLCDLIESNHPIVLGPNNTNLPK03538.7402 EEAVQTFNYLCDLIESNHPIVLGPNNTNLPKlight4+885.69233538.74021335.9373 
IFSIIAEGEMHEAIKHEDPCAK12524.2090 IFSIIAEGEMHEAIKHEDPCAKlight3+842.41032524.20901334.2926 
IFSIIAEGEMHEAIKHEDPCAK12524.2090 IFSIIAEGEMHEAIKHEDPCAKlight4+632.05952524.20901326.2993 
IFSIIAEGEMHEAIKHEDPCAK12524.2090 IFSIIAEGEMHEAIKHEDPCAKlight5+505.84912524.20901321.5033 
IFSIIAEGEMHEAIK01686.8651 IFSIIAEGEMHEAIKlight3+563.29561686.86511323.6862 
RLANVVR1826.5137 RLANVVRlight2+414.2641826.51371315.3329 
sp|O00584|RNT2_HUMAN Ribonuclease T2 OS=Homo sapiens GN=RNASET2 PE=1 SV=2
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
KLIMVQHWPETVCEK11896.9590 KLIMVQHWPETVCEKlight2+949.48681896.95901331.3896 
KLIMVQHWPETVCEK11896.9590 KLIMVQHWPETVCEKlight3+633.32691896.95901326.3474 
KLIMVQHWPETVCEK11896.9590 KLIMVQHWPETVCEKlight4+475.24701896.95901320.3404 
LIMVQHWPETVCEK01768.8640 LIMVQHWPETVCEKlight2+885.43931768.86401329.4682 
LIMVQHWPETVCEK01768.8640 LIMVQHWPETVCEKlight3+590.62861768.86401324.7249 
LIMVQHWPETVCEK01784.8590 LIMVQHWPETVCEKlight3+595.96031784.85901324.9275 
IQNDCRDPPDYWTIHGLWPDK12625.2071 IQNDCRDPPDYWTIHGLWPDKlight3+876.07632625.20711335.5719 
IQNDCRDPPDYWTIHGLWPDK12625.2071 IQNDCRDPPDYWTIHGLWPDKlight4+657.30902625.20711327.2587 
DPPDYWTIHGLWPDK01838.8628 DPPDYWTIHGLWPDKlight2+920.43871838.86281330.5182 
DPPDYWTIHGLWPDK01838.8628 DPPDYWTIHGLWPDKlight3+613.96151838.86281325.6115 
SWPFNLEEIK01261.6343 SWPFNLEEIKlight2+631.82441261.63431321.8597 
SWPFNLEEIKDLLPEMR12116.0663 SWPFNLEEIKDLLPEMRlight3+706.36272116.06631329.1228 
HGTCAAQVDALNSQKK11726.8421 HGTCAAQVDALNSQKKlight2+864.42831726.84211328.8378 
HGTCAAQVDALNSQKK11726.8421 HGTCAAQVDALNSQKKlight3+576.62131726.84211324.1926 
HGTCAAQVDALNSQKK11726.8421 HGTCAAQVDALNSQKKlight4+432.71781726.84211318.7243 
HGTCAAQVDALNSQK01598.7471 HGTCAAQVDALNSQKlight2+800.38081598.74711326.9164 
HGTCAAQVDALNSQK01598.7471 HGTCAAQVDALNSQKlight3+533.92301598.74711322.5701 
SLELYRELDLNSVLLK11904.0619 SLELYRELDLNSVLLKlight3+635.69461904.06191326.4374 
ELDLNSVLLK01142.6547 ELDLNSVLLKlight2+572.33461142.65471320.0750 
LGIKPSINYYQVADFK01854.9880 LGIKPSINYYQVADFKlight2+928.50131854.98801330.7600 
LGIKPSINYYQVADFK01854.9880 LGIKPSINYYQVADFKlight3+619.33661854.98801325.8158 
LGIKPSINYYQVADFK01854.9880 LGIKPSINYYQVADFKlight4+464.75431854.98801319.9417 
LGIKPSINYYQVADFKDALAR12381.2743 LGIKPSINYYQVADFKDALARlight4+596.32592381.27431324.9414 
PSINYYQVADFK01443.7034 PSINYYQVADFKlight2+722.85901443.70341324.5908 
IQCLPPSQDEEVQTIGQIELCLTK02798.3830 IQCLPPSQDEEVQTIGQIELCLTKlight3+933.80162798.38301337.7655 
QEVWLANGAAESR01429.6950 QEVWLANGAAESRlight2+715.85481429.69501324.3806 
VCEDGPVFYPPPK01503.7068 VCEDGPVFYPPPKlight2+752.86071503.70681325.4908 
VCEDGPVFYPPPKK11631.8018 VCEDGPVFYPPPKKlight3+544.94121631.80181322.9888 
VCEDGPVFYPPPKK11631.8018 VCEDGPVFYPPPKKlight4+408.95771631.80181317.8214 
sp|O00622|CYR61_HUMAN Protein CYR61 OS=Homo sapiens GN=CYR61 PE=1 SV=1
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
CAPGVGLVR0927.4960 CAPGVGLVRlight2+464.7553927.49601316.8477 
GLECNFGASSTALK01453.6871 GLECNFGASSTALKlight2+727.85081453.68711324.7405 
AQSEGRPCEYNSR01552.6689 AQSEGRPCEYNSRlight3+518.56361552.66891321.9864 
IYQNGESFQPNCK01583.7038 IYQNGESFQPNCKlight2+792.85921583.70381326.6908 
HQCTCIDGAVGCIPLCPQELSLPNLGCPNPR03532.6142 HQCTCIDGAVGCIPLCPQELSLPNLGCPNPRlight3+1178.54533532.61421347.0657 
HQCTCIDGAVGCIPLCPQELSLPNLGCPNPR03532.6142 HQCTCIDGAVGCIPLCPQELSLPNLGCPNPRlight4+884.16083532.61421335.8791 
HQCTCIDGAVGCIPLCPQELSLPNLGCPNPR03532.6142 HQCTCIDGAVGCIPLCPQELSLPNLGCPNPRlight5+707.53013532.61421329.1671 
ELGFDASEVELTR01464.7096 ELGFDASEVELTRlight2+733.36211464.70961324.9059 
NNELIAVGK0956.5291 NNELIAVGKlight2+479.2718956.52911317.2832 
CIVQTTSWSQCSK01583.7072 CIVQTTSWSQCSKlight2+792.86091583.70721326.6908 
VTNDNPECR01103.4666 VTNDNPECRlight2+552.74061103.46661319.4872 
ICEVRPCGQPVYSSLK01891.9284 ICEVRPCGQPVYSSLKlight3+631.65011891.92841326.2837 
FTYAGCLSVK01144.5587 FTYAGCLSVKlight2+573.28661144.55871320.1036 
YCGSCVDGR01072.4066 YCGSCVDGRlight2+537.21061072.40661319.0213 
CCTPQLTR01034.4637 CCTPQLTRlight2+518.23911034.46371318.4522 
FRCEDGETFSK11374.5874 FRCEDGETFSKlight2+688.30101374.58741323.5540 
CEDGETFSK01071.4179 CEDGETFSKlight2+536.71621071.41791319.0065 
NVMMIQSCK01109.5032 NVMMIQSCKlight2+555.75891109.50321319.5778 
NVMMIQSCK01125.4981 NVMMIQSCKlight2+563.75631125.49811319.8177 
CNYNCPHANEAAFPFYR02129.8836 CNYNCPHANEAAFPFYRlight3+710.96852129.88361329.2978 
sp|O14786|NRP1_HUMAN Neuropilin-1 OS=Homo sapiens GN=NRP1 PE=1 SV=3
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
CGDTIKIESPGYLTSPGYPHSYHPSEK13019.4022 CGDTIKIESPGYLTSPGYPHSYHPSEKlight5+604.88773019.40221325.2667 
IESPGYLTSPGYPHSYHPSEK02345.0964 IESPGYLTSPGYPHSYHPSEKlight3+782.70612345.09641332.0238 
IESPGYLTSPGYPHSYHPSEK02345.0964 IESPGYLTSPGYPHSYHPSEKlight4+587.28142345.09641324.5977 
IAPPPVVSSGPFLFIK01667.9651 IAPPPVVSSGPFLFIKlight2+834.98981667.96511327.9547 
IAPPPVVSSGPFLFIK01667.9651 IAPPPVVSSGPFLFIKlight3+556.99561667.96511323.4468 
FVSDYETHGAGFSIR01684.7845 FVSDYETHGAGFSIRlight3+562.60211684.78451323.6599 
YDRLEIWDGFPDVGPHIGR12241.0967 YDRLEIWDGFPDVGPHIGRlight4+561.28152241.09671323.6097 
SSSGILSMVFYTDSAIAK01875.9288 SSSGILSMVFYTDSAIAKlight3+626.31691875.92881326.0810 
FVTAVGTQGAISK01277.6980 FVTAVGTQGAISKlight2+639.85631277.69801322.1007 
EGNKPVLFQGNTNPTDVVVAVFPK02569.3540 EGNKPVLFQGNTNPTDVVVAVFPKlight3+857.45862569.35401334.8644 
EGNKPVLFQGNTNPTDVVVAVFPKPLITR03149.7237 EGNKPVLFQGNTNPTDVVVAVFPKPLITRlight4+788.43823149.72371332.2417 
SFEGNNNYDTPELR01654.7223 SFEGNNNYDTPELRlight2+828.36841654.72231327.7561 
LYQVIFEGEIGK01394.7446 LYQVIFEGEIGKlight2+698.37961394.74461323.8564 
DKLNTQSTYSEA11355.6205 DKLNTQSTYSEAlight2+678.81751355.62051323.2695 
sp|O14818|PSA7_HUMAN Proteasome subunit alpha type-7 OS=Homo sapiens GN=PSMA7 PE=1 SV=1
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
AITVFSPDGHLFQVEYAQEAVK02448.2325 AITVFSPDGHLFQVEYAQEAVKlight3+817.08482448.23251333.3302 
AITVFSPDGHLFQVEYAQEAVK02448.2325 AITVFSPDGHLFQVEYAQEAVKlight4+613.06542448.23251325.5775 
AITVFSPDGHLFQVEYAQEAVKK12576.3275 AITVFSPDGHLFQVEYAQEAVKKlight3+859.78312576.32751334.9528 
AITVFSPDGHLFQVEYAQEAVKK12576.3275 AITVFSPDGHLFQVEYAQEAVKKlight4+645.08912576.32751326.7944 
GRDIVVLGVEK11183.6925 GRDIVVLGVEKlight2+592.85351183.69251320.6906 
GRDIVVLGVEKK21311.7874 GRDIVVLGVEKKlight3+438.26981311.78741318.9353 
DIVVLGVEK0970.5699 DIVVLGVEKlight2+486.2922970.56991317.4938 
KICALDDNVCMAFAGLTADAR12311.0759 KICALDDNVCMAFAGLTADARlight2+1156.54522311.07591337.6014 
KICALDDNVCMAFAGLTADAR12311.0759 KICALDDNVCMAFAGLTADARlight3+771.36592311.07591331.5929 
ICALDDNVCMAFAGLTADAR02182.9809 ICALDDNVCMAFAGLTADARlight2+1092.49772182.98091335.6799 
ICALDDNVCMAFAGLTADAR02182.9809 ICALDDNVCMAFAGLTADARlight3+728.66762182.98091329.9704 
ICALDDNVCMAFAGLTADAR02198.9759 ICALDDNVCMAFAGLTADARlight2+1100.49522198.97591335.9199 
ICALDDNVCMAFAGLTADAR02198.9759 ICALDDNVCMAFAGLTADARlight3+733.99922198.97591330.1730 
LTVEDPVTVEYITR01633.8563 LTVEDPVTVEYITRlight2+817.93541633.85631327.4431 
LTVEDPVTVEYITR01633.8563 LTVEDPVTVEYITRlight3+545.62601633.85631323.0148 
RPFGISALIVGFDFDGTPR02064.0793 RPFGISALIVGFDFDGTPRlight2+1033.04692064.07931133.8964 
RPFGISALIVGFDFDGTPR02064.0793 RPFGISALIVGFDFDGTPRlight3+689.03372064.07931328.4643 
LYQTDPSGTYHAWK01665.7787 LYQTDPSGTYHAWKlight2+833.89661665.77871327.9219 
LYQTDPSGTYHAWK01665.7787 LYQTDPSGTYHAWKlight3+556.26681665.77871323.4191 
LYQTDPSGTYHAWK01665.7787 LYQTDPSGTYHAWKlight4+417.45201665.77871318.1442 
NYTDEAIETDDLTIK01739.8101 NYTDEAIETDDLTIKlight2+870.91231739.81011329.0324 
NYTDEAIETDDLTIK01739.8101 NYTDEAIETDDLTIKlight3+580.94401739.81011324.3569 
ALLEVVQSGGK01099.6237 ALLEVVQSGGKlight2+550.81911099.62371319.4296 
NIELAVMR0944.5113 NIELAVMRlight2+473.2629944.51131317.1029 
NIELAVMR0960.5063 NIELAVMRlight2+481.2604960.50631317.3428 
ILNPEEIEK01083.5812 ILNPEEIEKlight2+542.79791083.58121319.1889 
YVAEIEK0850.4436 YVAEIEKlight2+426.2291850.44361315.6919 
YVAEIEKEKEENEK21736.8469 YVAEIEKEKEENEKlight2+869.43071736.84691328.9879 
YVAEIEKEKEENEK21736.8469 YVAEIEKEKEENEKlight3+579.95621736.84691324.3193 
YVAEIEKEKEENEK21736.8469 YVAEIEKEKEENEKlight4+435.21901736.84691318.8193 
sp|O15145|ARPC3_HUMAN Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens GN=ARPC3 PE=1 SV=3
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
PAYHSSLMDPDTK01460.6606 PAYHSSLMDPDTKlight2+731.33761460.66061324.8451 
PAYHSSLMDPDTK01460.6606 PAYHSSLMDPDTKlight3+487.89411460.66061320.8210 
PAYHSSLMDPDTK01476.6555 PAYHSSLMDPDTKlight3+493.22581476.65551321.0236 
PAYHSSLMDPDTKLIGNMALLPIR12652.3768 PAYHSSLMDPDTKLIGNMALLPIRlight4+664.10152652.37681327.5169 
LIGNMALLPIR01209.7267 LIGNMALLPIRlight2+605.87071209.72671321.0811 
LIGNMALLPIR01209.7267 LIGNMALLPIRlight3+404.24951209.72671317.6425 
LIGNMALLPIR01225.7217 LIGNMALLPIRlight2+613.86811225.72171321.3210 
ETKDTDIVDEAIYYFK11948.9306 ETKDTDIVDEAIYYFKlight2+975.47261948.93061332.1692 
ETKDTDIVDEAIYYFK11948.9306 ETKDTDIVDEAIYYFKlight3+650.65081948.93061327.0057 
DTDIVDEAIYYFK01590.7454 DTDIVDEAIYYFKlight2+796.38001590.74541326.7964 
DTDIVDEAIYYFK01590.7454 DTDIVDEAIYYFKlight3+531.25571590.74541322.4687 
NYEIKNEADR11250.5891 NYEIKNEADRlight2+626.30181250.58911321.6941 
NYEIKNEADR11250.5891 NYEIKNEADRlight3+417.87031250.58911318.1601 
SQGEKEMYTLGITNFPIPGEPGFPLNAIYAK13381.6955 SQGEKEMYTLGITNFPIPGEPGFPLNAIYAKlight3+1128.23913381.69551345.1541 
EMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMR14150.0544 EMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRlight4+1038.52094150.05441341.7448 
EMYTLGITNFPIPGEPGFPLNAIYAK02852.4459 EMYTLGITNFPIPGEPGFPLNAIYAKlight3+951.82262852.44591338.4503 
EMYTLGITNFPIPGEPGFPLNAIYAKPANK03262.6737 EMYTLGITNFPIPGEPGFPLNAIYAKPANKlight3+1088.56523262.67371343.6465 
EMYTLGITNFPIPGEPGFPLNAIYAK02868.4408 EMYTLGITNFPIPGEPGFPLNAIYAKlight3+957.15422868.44081338.6529 
PANKQEDEVMR11315.6190 PANKQEDEVMRlight2+658.81681315.61901322.6695 
PANKQEDEVMR11315.6190 PANKQEDEVMRlight3+439.54701315.61901318.9838 
PANKQEDEVMR11331.6140 PANKQEDEVMRlight3+444.87861331.61401319.1864 
AYLQQLRQETGLR11574.8529 AYLQQLRQETGLRlight3+525.95821574.85291322.2674 
AYLQQLR0890.4974 AYLQQLRlight2+446.2560890.49741316.2927 
VFDPQNDKPSK01273.6303 VFDPQNDKPSKlight2+637.82241273.63031322.0397 
VFDPQNDKPSK01273.6303 VFDPQNDKPSKlight3+425.55071273.63031318.4519 
VFDPQNDKPSKWWTCFVK12281.0990 VFDPQNDKPSKWWTCFVKlight4+571.28202281.09901323.9897 
WWTCFVK01025.4793 WWTCFVKlight2+513.74691025.47931318.3174 
sp|O60506|HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
VAEKLDEIYVAGLVAHSDLDER12441.2438 VAEKLDEIYVAGLVAHSDLDERlight3+814.75522441.24381333.2417 
VAEKLDEIYVAGLVAHSDLDER12441.2438 VAEKLDEIYVAGLVAHSDLDERlight4+611.31822441.24381325.5111 
LDEIYVAGLVAHSDLDER02014.0007 LDEIYVAGLVAHSDLDERlight2+1008.00762014.00071333.1452 
LDEIYVAGLVAHSDLDER02014.0007 LDEIYVAGLVAHSDLDERlight3+672.34092014.00071327.8300 
AIEALKEFNEDGALAVLQQFKDSDLSHVQNK23456.7525 AIEALKEFNEDGALAVLQQFKDSDLSHVQNKlight3+1153.25813456.75251346.1048 
AIEALKEFNEDGALAVLQQFKDSDLSHVQNK23456.7525 AIEALKEFNEDGALAVLQQFKDSDLSHVQNKlight4+865.19543456.75251335.1584 
AIEALKEFNEDGALAVLQQFKDSDLSHVQNK23456.7525 AIEALKEFNEDGALAVLQQFKDSDLSHVQNKlight5+692.35783456.75251328.5906 
AIEALKEFNEDGALAVLQQFK12333.2267 AIEALKEFNEDGALAVLQQFKlight2+1167.62062333.22671337.9336 
AIEALKEFNEDGALAVLQQFK12333.2267 AIEALKEFNEDGALAVLQQFKlight3+778.74952333.22671331.8735 
EFNEDGALAVLQQFKDSDLSHVQNK12831.3726 EFNEDGALAVLQQFKDSDLSHVQNKlight4+708.85042831.37261329.2173 
EFNEDGALAVLQQFK01707.8468 EFNEDGALAVLQQFKlight2+854.93071707.84681328.5529 
EFNEDGALAVLQQFK01707.8468 EFNEDGALAVLQQFKlight3+570.28951707.84681323.9520 
DSDLSHVQNK01141.5364 DSDLSHVQNKlight2+571.77551141.53641320.0583 
SAFLCGVMK01027.4831 SAFLCGVMKlight2+514.74881027.48311318.3475 
SAFLCGVMK01011.4882 SAFLCGVMKlight2+506.75141011.48821318.1075 
VADSSKGPDEAK11202.5779 VADSSKGPDEAKlight2+602.29621202.57791320.9739 
VADSSKGPDEAK11202.5779 VADSSKGPDEAKlight3+401.86661202.57791317.5519 
TGYTLDVTTGQRK11438.7416 TGYTLDVTTGQRKlight2+720.37811438.74161324.5163 
TGYTLDVTTGQRK11438.7416 TGYTLDVTTGQRKlight3+480.58781438.74161320.5433 
TGYTLDVTTGQR01310.6466 TGYTLDVTTGQRlight2+656.33061310.64661322.5949 
TGYTLDVTTGQR01310.6466 TGYTLDVTTGQRlight3+437.88951310.64661318.9208 
KYGGPPPDSVYSGQQPSVGTEIFVGK12693.3337 KYGGPPPDSVYSGQQPSVGTEIFVGKlight3+898.78522693.33371336.4348 
KYGGPPPDSVYSGQQPSVGTEIFVGKIPR23059.5716 KYGGPPPDSVYSGQQPSVGTEIFVGKIPRlight4+765.90023059.57161331.3852 
YGGPPPDSVYSGQQPSVGTEIFVGKIPR12931.4767 YGGPPPDSVYSGQQPSVGTEIFVGKIPRlight3+978.16622931.47671339.4513 
YGGPPPDSVYSGQQPSVGTEIFVGK02565.2387 YGGPPPDSVYSGQQPSVGTEIFVGKlight3+856.08692565.23871334.8123 
IPRDLFEDELVPLFEK11959.0353 IPRDLFEDELVPLFEKlight3+654.01911959.03531327.1337 
DLFEDELVPLFEK01592.7974 DLFEDELVPLFEKlight2+797.40601592.79741326.8272 
DLFEDELVPLFEK01592.7974 DLFEDELVPLFEKlight3+531.93971592.79741322.4947 
AGPIWDLR0926.4974 AGPIWDLRlight2+464.2560926.49741316.8327 
LMMDPLTGLNR01259.6366 LMMDPLTGLNRlight2+630.82561259.63661321.8298 
LMMDPLTGLNR01275.6315 LMMDPLTGLNRlight2+638.82301275.63151322.0697 
LMMDPLTGLNR01275.6315 LMMDPLTGLNRlight2+638.82301275.63151322.0697 
GYAFVTFCTK01192.5587 GYAFVTFCTKlight2+597.28661192.55871320.8236 
EAAQEAVK0844.4290 EAAQEAVKlight2+423.2218844.42901315.6017 
LYNNHEIR01057.5305 LYNNHEIRlight2+529.77251057.53051318.7982 
HIGVCISVANNR01338.6827 HIGVCISVANNRlight2+670.34861338.68271323.0155 
HIGVCISVANNR01338.6827 HIGVCISVANNRlight3+447.23481338.68271319.2759 
LFVGSIPK0859.5167 LFVGSIPKlight2+430.7656859.51671315.8280 
TKEQILEEFSK11350.7031 TKEQILEEFSKlight2+676.35881350.70311323.1958 
TKEQILEEFSK11350.7031 TKEQILEEFSKlight3+451.24161350.70311319.4282 
EQILEEFSK01121.5605 EQILEEFSKlight2+561.78751121.56051319.7586 
VTEGLTDVILYHQPDDK01941.9684 VTEGLTDVILYHQPDDKlight2+971.99151941.96841332.0647 
VTEGLTDVILYHQPDDK01941.9684 VTEGLTDVILYHQPDDKlight3+648.33011941.96841326.9175 
VTEGLTDVILYHQPDDKKK22198.1583 VTEGLTDVILYHQPDDKKKlight3+733.72672198.15831330.1626 
VTEGLTDVILYHQPDDKKK22198.1583 VTEGLTDVILYHQPDDKKKlight4+550.54692198.15831323.2018 
VTEGLTDVILYHQPDDKK12070.0633 VTEGLTDVILYHQPDDKKlight4+518.52312070.06331321.9849 
NRGFCFLEYEDHK11713.7569 NRGFCFLEYEDHKlight2+857.88571713.75691328.6416 
NRGFCFLEYEDHK11713.7569 NRGFCFLEYEDHKlight3+572.25961713.75691324.0269 
NRGFCFLEYEDHK11713.7569 NRGFCFLEYEDHKlight4+429.44651713.75691318.6000 
GFCFLEYEDHK01443.6129 GFCFLEYEDHKlight2+722.81371443.61291324.5894 
GFCFLEYEDHK01443.6129 GFCFLEYEDHKlight3+482.21161443.61291320.6050 
VKVWGNVGTVEWADPIEDPDPEVMAK12880.4004 VKVWGNVGTVEWADPIEDPDPEVMAKlight3+961.14072880.40041338.8043 
VWGNVGTVEWADPIEDPDPEVMAK02669.2319 VWGNVGTVEWADPIEDPDPEVMAKlight3+890.75132669.23191336.1295 
VWGNVGTVEWADPIEDPDPEVMAK02653.2370 VWGNVGTVEWADPIEDPDPEVMAKlight3+885.41962653.23701335.9269 
NLANTVTEEILEK01472.7722 NLANTVTEEILEKlight2+737.39341472.77221325.0268 
NLANTVTEEILEK01472.7722 NLANTVTEEILEKlight3+491.93141472.77221320.9744 
NLANTVTEEILEKAFSQFGKLER22636.3810 NLANTVTEEILEKAFSQFGKLERlight4+660.10252636.38101327.3649 
KLKDYAFIHFDER21680.8624 KLKDYAFIHFDERlight3+561.29471680.86241323.6102 
LKDYAFIHFDER11552.7674 LKDYAFIHFDERlight3+518.59641552.76741321.9877 
LKDYAFIHFDERDGAVK22023.0163 LKDYAFIHFDERDGAVKlight4+506.76142023.01631321.5379 
DYAFIHFDERDGAVK11781.8373 DYAFIHFDERDGAVKlight3+594.95301781.83731324.8892 
DYAFIHFDERDGAVK11781.8373 DYAFIHFDERDGAVKlight4+446.46661781.83731319.2467 
DYAFIHFDER01311.5884 DYAFIHFDERlight2+656.80151311.58841322.6090 
DYAFIHFDER01311.5884 DYAFIHFDERlight3+438.20341311.58841318.9327 
AMEEMNGK0908.3732 AMEEMNGKlight2+455.1939908.37321316.5608 
AMEEMNGKDLEGENIEIVFAKPPDQK12931.3994 AMEEMNGKDLEGENIEIVFAKPPDQKlight4+733.85712931.39941330.1676 
DLEGENIEIVFAKPPDQK02041.0368 DLEGENIEIVFAKPPDQKlight2+1021.52572041.03681333.5508 
DLEGENIEIVFAKPPDQK02041.0368 DLEGENIEIVFAKPPDQKlight3+681.35292041.03681328.1724 
RKADGYNQPDSK21377.6637 RKADGYNQPDSKlight2+689.83911377.66371323.6002 
RKADGYNQPDSK21377.6637 RKADGYNQPDSKlight3+460.22851377.66371319.7697 
KADGYNQPDSK11221.5626 KADGYNQPDSKlight2+611.78861221.56261321.2587 
KADGYNQPDSK11221.5626 KADGYNQPDSKlight3+408.19481221.56261317.7924 
ADGYNQPDSK01093.4676 ADGYNQPDSKlight2+547.74111093.46761319.3372 
QTNNQNWGSQPIAQQPLQGGDHSGNYGYK03186.4504 QTNNQNWGSQPIAQQPLQGGDHSGNYGYKlight3+1063.15743186.45041342.6810 
QTNNQNWGSQPIAQQPLQGGDHSGNYGYK03186.4504 QTNNQNWGSQPIAQQPLQGGDHSGNYGYKlight4+797.61993186.45041332.5906 
SENQEFYQDTFGQQWK02033.8755 SENQEFYQDTFGQQWKlight2+1017.94502033.87551333.4434 
SENQEFYQDTFGQQWK02033.8755 SENQEFYQDTFGQQWKlight3+678.96582033.87551328.0817