unique_acK_PIQED_pan1_2018-01-11_15-27-39.sky.zip

Meyer_acylomes_diets
Protein Note/Annotations
 
sp|Q61694|3BHS5_MOUSE 3 beta-hydroxysteroid dehydrogenase type 5 OS=Mus musculus GN=Hsd3b5 PE=1 SV=4
Peptide Note/Annotations
Precursor Note/Annotations
VLKGDILDAQCLK11513.8174 VLKGDILDAQCLKlight2+757.91601513.8174925.6425 
VLKGDILDAQCLKR21669.9185 VLKGDILDAQCLKRlight3+557.64681669.91851223.4716 
VLKGDILDAQCLKR21711.9291 VLKGDILDAQCLKRlight3+571.65031711.92911224.0037 
MAEKAVLATNGR11301.6762 MAEKAVLATNGRlight2+651.84541301.67621122.4604 
LLKNGGTLHTCALR11594.8613 LLKNGGTLHTCALRlight3+532.62771594.86131322.5209 
DLGYQPLVSWEEAKQK11931.9629 DLGYQPLVSWEEAKQKlight3+644.99491931.96291326.7908 
TSEWIGTLVKQHR11595.8420 TSEWIGTLVKQHRlight3+532.95461595.84201322.5333 
sp|Q99L13|3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Hibadh PE=1 SV=1
Peptide Note/Annotations
Precursor Note/Annotations
NLMKHGYPLILYDVFPDVCK12463.2331 NLMKHGYPLILYDVFPDVCKlight3+822.08502463.23311333.5202 
EFKEAGEQVASSPAEVAEK12046.9746 EFKEAGEQVASSPAEVAEKlight2+1024.49462046.9746833.6398 
EFKEAGEQVASSPAEVAEK12046.9746 EFKEAGEQVASSPAEVAEKlight3+683.33212046.97461328.2476 
EAGEQVASSPAEVAEKADR11984.9338 EAGEQVASSPAEVAEKADRlight3+662.65191984.93381327.4618 
EVEKMGAVFMDAPVSGGVGAAR12219.0715 EVEKMGAVFMDAPVSGGVGAARlight3+740.69782219.07151330.4275 
LLAKILNMSSGR11343.7595 LLAKILNMSSGRlight2+672.88701343.75951223.0916 
LLAKILNMSSGR11343.7595 LLAKILNMSSGRlight3+448.92711343.75951119.3402 
LLAKILNMSSGR11359.7544 LLAKILNMSSGRlight2+680.88451359.7544923.3315 
DLGLAQDSATSTKTPILLGSLAHQIYR12910.5451 DLGLAQDSATSTKTPILLGSLAHQIYRlight3+971.18902910.54511339.1862 
DLGLAQDSATSTKTPILLGSLAHQIYR12910.5451 DLGLAQDSATSTKTPILLGSLAHQIYRlight4+728.64352910.54511329.9695 
sp|Q00898|A1AT5_MOUSE Alpha-1-antitrypsin 1-5 OS=Mus musculus GN=Serpina1e PE=1 SV=1
Peptide Note/Annotations
Precursor Note/Annotations
MQHLEQTLNKELISKFLLNR22538.3628 MQHLEQTLNKELISKFLLNRlight4+635.59802538.36281326.4337 
sp|Q9WVM8|AADAT_MOUSE Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Mus musculus GN=Aadat PE=1 SV=1
Peptide Note/Annotations
Precursor Note/Annotations
FEDDLIKR11076.5502 FEDDLIKRlight2+539.28241076.55021019.0835 
ILSQWKPEDSKDPTK11812.9258 ILSQWKPEDSKDPTKlight3+605.31591812.92581125.2830 
ADTFSKTVSSGLR11409.7151 ADTFSKTVSSGLRlight2+705.86481409.7151924.0809 
ADTFSKTVSSGLR11409.7151 ADTFSKTVSSGLRlight3+470.91231409.71511220.1757 
TIDFYKNQR11225.6091 TIDFYKNQRlight2+613.81181225.6091821.3194 
DSILAAADKWLR11399.7460 DSILAAADKWLRlight2+700.88031399.74601323.9314 
LAQLIKESL11055.6227 LAQLIKESLlight2+528.81861055.62271318.7696 
sp|Q99K67|AASS_MOUSE Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Mus musculus GN=Aass PE=1 SV=1
Peptide Note/Annotations
Precursor Note/Annotations
GITKLGYK1920.5331 GITKLGYKlight2+461.2738920.53311316.7432 
LGYKVLIQPSNR11428.8089 LGYKVLIQPSNRlight2+715.41171428.8089824.3674 
LGYKVLIQPSNR11428.8089 LGYKVLIQPSNRlight3+477.27691428.8089920.4175 
AIHDKEYVR11171.5986 AIHDKEYVRlight2+586.80661171.5986920.5092 
LIDYEKMVDHR11459.7130 LIDYEKMVDHRlight2+730.86381459.7130724.8309 
LIDYEKMVDHR11459.7130 LIDYEKMVDHRlight3+487.57831459.71301320.8090 
EVSKTGDLR11045.5404 EVSKTGDLRlight2+523.77751045.5404918.6183 
KTDGVYDPVEYEKYPER22128.9953 KTDGVYDPVEYEKYPERlight3+710.67242128.99531329.2866 
KYNINPVSLTVGKQEAK21930.0524 KYNINPVSLTVGKQEAKlight3+644.35811930.05241326.7666 
DSIKYAEIYGISSAHTLLR12178.1321 DSIKYAEIYGISSAHTLLRlight3+727.05132178.13211129.9090 
DSIKYAEIYGISSAHTLLR12178.1321 DSIKYAEIYGISSAHTLLRlight4+545.54032178.13211323.0115 
SSPCEKLK1989.4852 SSPCEKLKlight2+495.7499989.48521317.7775 
sp|P05202|AATM_MOUSE Aspartate aminotransferase, mitochondrial OS=Mus musculus GN=Got2 PE=1 SV=1
Peptide Note/Annotations
Precursor Note/Annotations
KAEAQIAAKNLDK21440.7936 KAEAQIAAKNLDKlight3+481.27181440.79361320.5693 
NLDKEYLPIGGLAEFCK12007.9976 NLDKEYLPIGGLAEFCKlight3+670.33982007.99761027.7539 
ASAELALGENNEVLKSGR11898.9698 ASAELALGENNEVLKSGRlight2+950.49221898.9698531.4198 
ASAELALGENNEVLKSGR11898.9698 ASAELALGENNEVLKSGRlight3+633.99721898.96981326.3729 
DVFLPKPSWGNHTPIFR02052.0581 DVFLPKPSWGNHTPIFRlight3+685.02672052.05811328.3120 
IPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVK13860.0043 IPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKlight5+773.00813860.00431131.6553 
EIASVVKK1914.5437 EIASVVKKlight2+458.2791914.54371216.6534 
EIASVVKKK21084.6492 EIASVVKKKlight2+543.33191084.6492919.2050 
VGAFTVVCKDAEEAK11664.8080 VGAFTVVCKDAEEAKlight2+833.41131664.80801327.9073 
VGAFTVVCKDAEEAK11664.8080 VGAFTVVCKDAEEAKlight3+555.94331664.80801323.4068 
VGAFTVVCKDAEEAKR21820.9091 VGAFTVVCKDAEEAKRlight3+607.97701820.90911325.3841 
VGAFTVVCKDAEEAKR21820.9091 VGAFTVVCKDAEEAKRlight3+607.97701820.90911225.3841 
VGAFTVVCKDAEEAKR21862.9196 VGAFTVVCKDAEEAKRlight3+621.98051862.91961325.9163 
RVESQLKILIRPLYSNPPLNGAR22675.5235 RVESQLKILIRPLYSNPPLNGARlight4+669.88822675.52351327.7367 
VESQLKILIRPLYSNPPLNGAR12519.4224 VESQLKILIRPLYSNPPLNGARlight3+840.81472519.42241334.2320 
KQWLQEVKGMADR21629.8297 KQWLQEVKGMADRlight2+815.92211629.82971027.3827 
KQWLQEVKGMADR21629.8297 KQWLQEVKGMADRlight3+544.28381629.82971122.9638 
QWLQEVKGMADR11501.7347 QWLQEVKGMADRlight2+751.87461501.7347925.4612 
QWLQEVKGMADR11501.7347 QWLQEVKGMADRlight3+501.58551501.73471221.3412 
TQLVSNLKK11071.6288 TQLVSNLKKlight2+536.82171071.62881319.0096 
EGSSHNWQHITDQIGMFCFTGLKPEQVER03472.5929 EGSSHNWQHITDQIGMFCFTGLKPEQVERlight4+869.15553472.59291335.3089 
LTKEFSVYMTKDGR21715.8553 LTKEFSVYMTKDGRlight3+572.95901715.85531024.0534 
EFSVYMTKDGR11373.6286 EFSVYMTKDGRlight2+687.82161373.62861323.5396 
EFSVYMTKDGR11373.6286 EFSVYMTKDGRlight3+458.88351373.6286919.7186 
EFSVYMTKDGR11389.6235 EFSVYMTKDGRlight2+695.81901389.6235723.7796 
EFSVYMTKDGR11389.6235 EFSVYMTKDGRlight3+464.21511389.62351019.9212 
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3
Peptide Note/Annotations
Precursor Note/Annotations
YFNNEKYEAQR11502.6790 YFNNEKYEAQRlight2+752.34681502.67901025.4754 
sp|P55096|ABCD3_MOUSE ATP-binding cassette sub-family D member 3 OS=Mus musculus GN=Abcd3 PE=1 SV=2
Peptide Note/Annotations
Precursor Note/Annotations
AVVDKVFLSR11174.6710 AVVDKVFLSRlight2+588.34281174.67101120.5553 
RPIGKMTIMEQK11472.7843 RPIGKMTIMEQKlight3+491.93541472.78431320.9745 
MTIMEQKYEGEYR11718.7644 MTIMEQKYEGEYRlight2+860.38951718.7644728.7167 
EKQTIHSVFR11285.6779 EKQTIHSVFRlight2+643.84621285.6779822.2204 
EKQTIHSVFR11285.6779 EKQTIHSVFRlight3+429.56661285.67791218.6045 
ITELMQVLKDLNHGR11807.9615 ITELMQVLKDLNHGRlight3+603.66111807.96151325.2201 
DQVIYPDGKEDQKK21703.8366 DQVIYPDGKEDQKKlight3+568.95281703.83661123.9012 
DQVIYPDGKEDQKK21703.8366 DQVIYPDGKEDQKKlight3+568.95281703.83661323.9012 
GNYEFKK1926.4498 GNYEFKKlight2+464.2322926.4498816.8320 
sp|Q8K4F5|ABHDB_MOUSE Alpha/beta hydrolase domain-containing protein 11 OS=Mus musculus GN=Abhd11 PE=1 SV=1
Peptide Note/Annotations
Precursor Note/Annotations
TNFNSLAKAMVQR11520.7769 TNFNSLAKAMVQRlight2+761.39581520.77691025.7469 
TNFNSLAKAMVQR11520.7769 TNFNSLAKAMVQRlight3+507.93291520.77691321.5825 
LADKQLSSVVK11228.7027 LADKQLSSVVKlight2+615.35861228.70271221.3658 
sp|P51174|ACADL_MOUSE Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acadl PE=1 SV=2
Peptide Note/Annotations
Precursor Note/Annotations
LETPSAKK1914.5073 LETPSAKKlight2+458.2609914.50731316.6528 
KFFQEEVIPHHTEWEKAGEVSR22724.3296 KFFQEEVIPHHTEWEKAGEVSRlight4+682.08972724.32961228.2004 
KFFQEEVIPHHTEWEKAGEVSR22724.3296 KFFQEEVIPHHTEWEKAGEVSRlight5+545.87322724.32961323.0242 
FFQEEVIPHHTEWEKAGEVSR12596.2347 FFQEEVIPHHTEWEKAGEVSRlight3+866.41882596.23471335.2049 
FFQEEVIPHHTEWEKAGEVSR12596.2347 FFQEEVIPHHTEWEKAGEVSRlight4+650.06592596.23471326.9835 
EVWEKAGK1987.5025 EVWEKAGKlight2+494.7585987.50251217.7478 
EQIEKFIPQMTAGK11660.8494 EQIEKFIPQMTAGKlight2+831.43201660.84941327.8480 
EQIEKFIPQMTAGK11660.8494 EQIEKFIPQMTAGKlight3+554.62381660.84941323.3567 
AFVDSCLQLHETKR11744.8567 AFVDSCLQLHETKRlight3+582.62621744.85671324.4208