Protein / Label:sp|Q8TDQ0|HAVR2_HUMAN
Description:Hepatitis A virus cellular receptor 2 OS=Homo sapiens GN=HAVCR2 PE=1 SV=3
Decoy:false
Note: 
File:TIM3_20170419_2017-06-26_15-30-14.sky.zip
0102030405060708090
SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDE
1 1 1 1 1 1 >>
100110120130140150160170180
KFNLKLVIKPAKVTPAPTLQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRAHHHHHHHHHH
> 1 1 1 1 1
DescriptionHepatitis A virus cellular receptor 2 OS=Homo sapiens GN=HAVCR2 PE=1 SV=3
Gene name(s)HAVCR2
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded Q8TDQ0
HAVR2_HUMAN
none loaded none loaded none loaded

Peak Areas

Retention Times