Protein / Label:sp|A0M8Q6|LAC7_HUMAN
Description:Ig lambda-7 chain C region OS=Homo sapiens GN=IGLC7 PE=1 SV=2
Decoy:false
Note: 
File:IgG_20151216_2016-02-08_08-48-47.sky.zip
0102030405060708090
GQPKAAPSVTLFPPSSEELQANKATLVCLVSDFYPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCRVTHEGSTVEKTV
1 1 1
100
APAECS
DescriptionIg lambda-7 chain C region
Gene name(s)IGLC7
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded A0M8Q6
LAC7_HUMAN
none loaded none loaded GO:0045087
GO:0038096
GO:0038095
GO:0006958
GO:0005886
GO:0005576
GO:0003823

Peak Areas

Retention Times