Protein / Label:sp|P0CF74|LAC6_HUMAN
Description:Ig lambda-6 chain C region OS=Homo sapiens GN=IGLC6 PE=4 SV=1
Decoy:false
Note: 
File:IgG_20151216_2016-02-08_08-48-47.sky.zip
0102030405060708090
GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTV
1 1 <
100
APAECS
<< 1
DescriptionIg lambda-6 chain C region
Gene name(s)IGLC6
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P0CF74
IGLC6_HUMAN
LAC6_HUMAN
none loaded none loaded GO:0045087
GO:0038096
GO:0038095
GO:0006958
GO:0005886
GO:0005576
GO:0003823

Peak Areas

Retention Times