Protein / Label:sp|P0CG05|LAC2_HUMAN
Description:Ig lambda-2 chain C regions OS=Homo sapiens GN=IGLC2 PE=1 SV=1
Decoy:false
Note: 
File:IgG_20151216_2016-02-08_08-48-47.sky.zip
0102030405060708090
GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTV
1 1 1
100
APTECS
DescriptionIg lambda-2 chain C regions
Gene name(s)IGLC2
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P0DOY2
P80423
P0CG05
A0M8Q4
IGLC2_HUMAN
LAC2_HUMAN
none loaded none loaded GO:0045087
GO:0038096
GO:0038095
GO:0006958
GO:0005886
GO:0005576
GO:0003823

Peak Areas

Retention Times