Protein / Label:sp|P10144|GRAB_HUMAN
Description:Granzyme B OS=Homo sapiens GN=GZMB PE=1 SV=2
Decoy:false
Note: 
File:Heavy-Granzyme-B_20151224_2016-02-08_09-40-40.sky.zip
0102030405060708090
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAY
1 1 1 1 1 >>
100110120130140150160170180190
NPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFK
> 1 1 1 1 1
200210220230240
GDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
1 1 1 1
DescriptionGranzyme B
Gene name(s)GZMB
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_004122.2
none loaded Q9UCC1
Q8N1D2
P10144
GRAB_HUMAN
ENST00000216341
none loaded GO:1900740
GO:0097193
GO:0019835
GO:0007219
GO:0006508
GO:0005829
GO:0005634
GO:0004252
GO:0001772

Peak Areas

Retention Times