Protein / Label:sp|P16410|CTLA4_HUMAN
Description:Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens GN=CTLA4 PE=1 SV=3
Decoy:false
Note: 
File:CTLA4_20170419_2017-06-26_13-48-37.sky.zip
0102030405060708090
AMHVAQPAVVLASSRGVASFECEYASSHNANEVRVTVLQQVASRTTEICAATYTVERELAFPEDSACAGTSSGTRVNLTIQGLRAADTGLYICKVELMYP
1 1 1 1 1 1
100110120130
PPYFVGTGNGTQIYVIDPEPCPDSDHHHHHH
DescriptionCytotoxic T-lymphocyte protein 4 OS=Homo sapiens GN=CTLA4 PE=1 SV=3
Gene name(s)CTLA4
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P16410
CTLA4_HUMAN
none loaded none loaded none loaded

Peak Areas

Retention Times