Protein / Label:sp|P00450|CERU_HUMAN
Description:Ceruloplasmin OS=Homo sapiens GN=CP PE=1 SV=1
Decoy:false
Note: 
File:Ceruloplasmin_20151216_2016-02-08_08-47-51.sky.zip
0102030405060708090
MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGPDRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAE
1 1 1 1 1
100110120130140150160170180190
TGDKVYVHLKNLASRPYTFHSHGITYYKEHEGAIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYHSHIDAPKDIASGLIGPLIIC
1 1 1 1 >>
200210220230240250260270280290
KKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFH
> 1 1 1 1 1 >>
300310320330340350360370380390
GQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTA
> 1 1 <
400410420430440450460470480490
PGSDSAVFFEQGTTRIGGSYKKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGVRFNKNNEGTYYSPNYNPQSR
<< 1 1 1 1 1
500510520530540550560570580590
SVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYYSAVDPTKDIFTGLIGPMKICKKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMF
1 1 1 1 1 1 <
600610620630640650660670680690
TTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLTMCKGDSVVWYLFSAGNEADVHGIYFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECL
<< 1 1 1
700710720730740750760770780790
TTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYKKVVYRQYTDSTFRVPVERKA
1 1 1 1 1 1 <
800810820830840850860870880890
EEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQTESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVC
<< 1 1 1 >>
900910920930940950960970980990
RRPYLKVFNPRRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHAINGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDLHTVHFHG
> 1 1 1 1
1000101010201030104010501060
HSFQYKHRGVYSSDVFDIFPGTYQTLEMFPRTPGIWLLHCHVTDHIHAGMETTYTVLQNEDTKSG
1
DescriptionCeruloplasmin
Gene name(s)CP
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000087.1
none loaded Q9UKS4
Q2PP18
Q14063
P00450
CERU_HUMAN
ENST00000264613
none loaded GO:0055085
GO:0006879
GO:0006825
GO:0005765
GO:0005615
GO:0005507
GO:0004322
PeptidePeptide Neutral MassMissed CleavagesAvg. Measured RTPredicted RTRT Score
ILILGIFLFLCSTPAWAK2062.16890   
HYYIGIIETTWDYASDHGEK2397.0913015.0356  
LISVDTEHSNIYLQNGPDR2170.0655012.3174  
ALYLQYTDETFR1518.7355014.0314  
TTIEKPVWLGFLGPIIK1911.1234017.1664  
NLASRPYTFHSHGITYYK2154.0647010.9212  
EHEGAIYPDNTTDFQR1891.83370   
IYHSHIDAPK1179.603708.0218  
DIASGLIGPLIICK1468.8323016.5258  
EFVVMFSVVDENFSWYLEDNIK2709.26730   
TYCSEPEK1012.417207.3284  
DNEDFQESNR1252.495608.5059  
MYSVNGYTFGSLPGLSMCAEDR2454.0654016.0243  
WYLFGMGNEVDVHAAFFHGQALTNK2851.35410   
AGLQAFFQVQECNK1638.78240   
HYYIAAEEIIWNYAPSGIDIFTK2713.34280   
ENLTAPGSDSAVFFEQGTTR2125.99160   
EYTDASFTNR1202.52040   
GPEEEHLGILGPVIWAEVGDTIR2486.28050   
GAYPLSIEPIGVR1370.7558014.2267  
NNEGTYYSPNYNPQSR1902.8133010.7438  
SVPPSASHVAPTETFTYEWTVPK2530.2380013.9020  
EVGPTNADPVCLAK1469.7184011.6215  
MYYSAVDPTK1173.5376011.1226  
DIFTGLIGPMK1190.6369016.1763  
GSLHANGR810.40960   
EFYLFPTVFDENESLLLEDNIR2702.31160   
MFTTAPDQVDK1251.58050   
EDEDFQESNK1239.48910   
MHSMNGFMYGNQPGLTMCK2202.9141012.9602  
YTVNQCR939.423307.8462  
QSEDSTFYLGER1430.6314012.2506  
TYYIAAVEVEWDYSPQR2088.9793015.7604  
ELHHLQEQNVSNAFLDK2020.99670   
GEFYIGSK899.4389011.3917  
QYTDSTFR1016.456309.6883  
AEEEHLGILGPQLHADVGDK2127.0596012.3532  
SGAGTEDSACIPWAYYSTVDQVK2504.1166015.0746  
DLYSGLIGPLIVCR1574.8491017.0963  
LEFALLFLVFDENESWYLDDNIK2832.38980   
TYSDHPEK975.429806.0796  
DDEEFIESNK1224.5146010.9262  
MHAINGR797.396606.8445  
GVYSSDVFDIFPGTYQTLEMFPR2668.2519018.2992  

Peak Areas

Retention Times