oxICAT_Mia40_21_44_2017-03-31_12-03-31.sky.zip

Warscheid Lab - yeast_oxICAT
Name: oxICAT_Mia40_21_44_2017-03-31_12-03-31.sky.zip (101 MB)   1 version
 
Protein / LabelDescriptionProtein Annotations 
sp|P00127|QCR6_YEAST Cytochrome b-c1 complex subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR6 PE=1 SV=2
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
EDCVEEFFHLQHYLDTATAPR02747.2650 EDCVEEFFHLQHYLDTATAPRlight2747.2650916.76233+M916.7623 
EDCVEEFFHLQHYLDTATAPR02747.2650 EDCVEEFFHLQHYLDTATAPRlight2747.2650916.76233+M+1917.0966 
EDCVEEFFHLQHYLDTATAPR02747.2650 EDCVEEFFHLQHYLDTATAPRlight2747.2650916.76233+M+2917.4307 
EDCVEEFFHLQHYLDTATAPR02747.2650 EDCVEEFFHLQHYLDTATAPRheavy2756.2952919.77233+M919.7723 
EDCVEEFFHLQHYLDTATAPR02747.2650 EDCVEEFFHLQHYLDTATAPRheavy2756.2952919.77233+M+1920.1066 
EDCVEEFFHLQHYLDTATAPR02747.2650 EDCVEEFFHLQHYLDTATAPRheavy2756.2952919.77233+M+2920.4407 
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
LGPLQGSMPPELVCPPYAPGETK02607.3077 LGPLQGSMPPELVCPPYAPGETKlight2607.30771304.66112+M1304.6611 
LGPLQGSMPPELVCPPYAPGETK02607.3077 LGPLQGSMPPELVCPPYAPGETKlight2607.30771304.66112+M+11305.1626 
LGPLQGSMPPELVCPPYAPGETK02607.3077 LGPLQGSMPPELVCPPYAPGETKlight2607.30771304.66112+M+21305.6636 
LGPLQGSMPPELVCPPYAPGETK02607.3077 LGPLQGSMPPELVCPPYAPGETKheavy2616.33791309.17622+M1309.1762 
LGPLQGSMPPELVCPPYAPGETK02607.3077 LGPLQGSMPPELVCPPYAPGETKheavy2616.33791309.17622+M+11309.6776 
LGPLQGSMPPELVCPPYAPGETK02607.3077 LGPLQGSMPPELVCPPYAPGETKheavy2616.33791309.17622+M+21310.1786 
VDISTDMLGSHVDVPFYVSATALCK02894.4194 VDISTDMLGSHVDVPFYVSATALCKlight2894.4194965.81373+M965.8137 
VDISTDMLGSHVDVPFYVSATALCK02894.4194 VDISTDMLGSHVDVPFYVSATALCKlight2894.4194965.81373+M+1966.1481 
VDISTDMLGSHVDVPFYVSATALCK02894.4194 VDISTDMLGSHVDVPFYVSATALCKheavy2903.4496968.82383+M968.8238 
VDISTDMLGSHVDVPFYVSATALCK02894.4194 VDISTDMLGSHVDVPFYVSATALCKheavy2903.4496968.82383+M+1969.1581 
sp|P00410|COX2_YEAST Cytochrome c oxidase subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX2 PE=1 SV=1
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
EGVFYGACSELCGTGHANMPIK02737.2662 EGVFYGACSELCGTGHANMPIKlight2737.2662913.42943+M913.4294 
EGVFYGACSELCGTGHANMPIK02737.2662 EGVFYGACSELCGTGHANMPIKlight2737.2662913.42943+M+1913.7636 
EGVFYGACSELCGTGHANMPIK02737.2662 EGVFYGACSELCGTGHANMPIKlight2737.2662913.42943+M+2914.0975 
EGVFYGACSELCGTGHANMPIK02737.2662 EGVFYGACSELCGTGHANMPIKheavy2755.3266919.44953+M919.4495 
EGVFYGACSELCGTGHANMPIK02737.2662 EGVFYGACSELCGTGHANMPIKheavy2755.3266919.44953+M+1919.7837 
EGVFYGACSELCGTGHANMPIK02737.2662 EGVFYGACSELCGTGHANMPIKheavy2755.3266919.44953+M+2920.1175 
sp|P00445|SODC_YEAST Superoxide dismutase [Cu-Zn] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOD1 PE=1 SV=2
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
GFHIHEFGDATNGCVSAGPHFNPFK02912.3453 GFHIHEFGDATNGCVSAGPHFNPFKlight2912.3453729.09364+M729.0936 
GFHIHEFGDATNGCVSAGPHFNPFK02912.3453 GFHIHEFGDATNGCVSAGPHFNPFKlight2912.3453729.09364+M+1729.3443 
GFHIHEFGDATNGCVSAGPHFNPFK02912.3453 GFHIHEFGDATNGCVSAGPHFNPFKlight2912.3453729.09364+M+2729.5949 
GFHIHEFGDATNGCVSAGPHFNPFK02912.3453 GFHIHEFGDATNGCVSAGPHFNPFKheavy2921.3755731.35114+M731.3511 
GFHIHEFGDATNGCVSAGPHFNPFK02912.3453 GFHIHEFGDATNGCVSAGPHFNPFKheavy2921.3755731.35114+M+1731.6018 
GFHIHEFGDATNGCVSAGPHFNPFK02912.3453 GFHIHEFGDATNGCVSAGPHFNPFKheavy2921.3755731.35114+M+2731.8524 
sp|P00549|KPYK1_YEAST Pyruvate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC19 PE=1 SV=2
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
AEVSDVGNAILDGADCVMLSGETAK02691.2731 AEVSDVGNAILDGADCVMLSGETAKlight2691.27311346.64382+M1346.6438 
AEVSDVGNAILDGADCVMLSGETAK02691.2731 AEVSDVGNAILDGADCVMLSGETAKlight2691.27311346.64382+M+11347.1453 
AEVSDVGNAILDGADCVMLSGETAK02691.2731 AEVSDVGNAILDGADCVMLSGETAKlight2691.27311346.64382+M+21347.6463 
AEVSDVGNAILDGADCVMLSGETAK02691.2731 AEVSDVGNAILDGADCVMLSGETAKheavy2700.30331351.15892+M1351.1589 
AEVSDVGNAILDGADCVMLSGETAK02691.2731 AEVSDVGNAILDGADCVMLSGETAKheavy2700.30331351.15892+M+11351.6603 
AEVSDVGNAILDGADCVMLSGETAK02691.2731 AEVSDVGNAILDGADCVMLSGETAKheavy2700.30331351.15892+M+21352.1613 
NCTPKPTSTTETVAASAVAAVFEQK02777.3906 NCTPKPTSTTETVAASAVAAVFEQKlight2777.3906926.80413+M926.8041 
NCTPKPTSTTETVAASAVAAVFEQK02777.3906 NCTPKPTSTTETVAASAVAAVFEQKlight2777.3906926.80413+M+1927.1384 
NCTPKPTSTTETVAASAVAAVFEQK02777.3906 NCTPKPTSTTETVAASAVAAVFEQKlight2777.3906926.80413+M+2927.4726 
NCTPKPTSTTETVAASAVAAVFEQK02777.3906 NCTPKPTSTTETVAASAVAAVFEQKheavy2786.4208929.81423+M929.8142 
NCTPKPTSTTETVAASAVAAVFEQK02777.3906 NCTPKPTSTTETVAASAVAAVFEQKheavy2786.4208929.81423+M+1930.1485 
NCTPKPTSTTETVAASAVAAVFEQK02777.3906 NCTPKPTSTTETVAASAVAAVFEQKheavy2786.4208929.81423+M+2930.4826 
sp|P00812|ARGI_YEAST Arginase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAR1 PE=1 SV=1
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVR03796.8077 AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVRlight3796.80771266.60983+M1266.6098 
AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVR03796.8077 AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVRlight3796.80771266.60983+M+11266.9441 
AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVR03796.8077 AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVRlight3796.80771266.60983+M+21267.2783 
AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVR03796.8077 AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVRheavy3805.83791269.61993+M1269.6199 
AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVR03796.8077 AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVRheavy3805.83791269.61993+M+11269.9542 
AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVR03796.8077 AVHPETNGEGPIMCSYDVDGVDPLYIPATGTPVRheavy3805.83791269.61993+M+21270.2883 
LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIAR04368.2206 LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIARlight4368.22061093.06244+M1093.0624 
LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIAR04368.2206 LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIARlight4368.22061093.06244+M+11093.3131 
LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIAR04368.2206 LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIARlight4368.22061093.06244+M+21093.5638 
LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIAR04368.2206 LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIARheavy4386.28101097.57754+M1097.5775 
LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIAR04368.2206 LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIARheavy4386.28101097.57754+M+11097.8282 
LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIAR04368.2206 LAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIARheavy4386.28101097.57754+M+21098.0788 
sp|P00817|IPYR_YEAST Inorganic pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPP1 PE=1 SV=4
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
NCFPHHGYIHNYGAFPQTWEDPNVSHPETK03748.6906 NCFPHHGYIHNYGAFPQTWEDPNVSHPETKlight3748.6906750.74545+M750.7454 
NCFPHHGYIHNYGAFPQTWEDPNVSHPETK03748.6906 NCFPHHGYIHNYGAFPQTWEDPNVSHPETKlight3748.6906750.74545+M+1750.9460 
NCFPHHGYIHNYGAFPQTWEDPNVSHPETK03748.6906 NCFPHHGYIHNYGAFPQTWEDPNVSHPETKlight3748.6906750.74545+M+2751.1465 
NCFPHHGYIHNYGAFPQTWEDPNVSHPETK03748.6906 NCFPHHGYIHNYGAFPQTWEDPNVSHPETKheavy3757.7208752.55145+M752.5514 
NCFPHHGYIHNYGAFPQTWEDPNVSHPETK03748.6906 NCFPHHGYIHNYGAFPQTWEDPNVSHPETKheavy3757.7208752.55145+M+1752.7520 
NCFPHHGYIHNYGAFPQTWEDPNVSHPETK03748.6906 NCFPHHGYIHNYGAFPQTWEDPNVSHPETKheavy3757.7208752.55145+M+2752.9525 
sp|P00927|THDH_YEAST Threonine dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV1 PE=1 SV=2
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
NQGVIACSAGNHAQGVAFAAK02240.1120 NQGVIACSAGNHAQGVAFAAKlight2240.1120747.71133+M747.7113 
NQGVIACSAGNHAQGVAFAAK02240.1120 NQGVIACSAGNHAQGVAFAAKlight2240.1120747.71133+M+1748.0456 
NQGVIACSAGNHAQGVAFAAK02240.1120 NQGVIACSAGNHAQGVAFAAKlight2240.1120747.71133+M+2748.3796 
NQGVIACSAGNHAQGVAFAAK02240.1120 NQGVIACSAGNHAQGVAFAAKheavy2249.1422750.72143+M750.7214 
NQGVIACSAGNHAQGVAFAAK02240.1120 NQGVIACSAGNHAQGVAFAAKheavy2249.1422750.72143+M+1751.0556 
NQGVIACSAGNHAQGVAFAAK02240.1120 NQGVIACSAGNHAQGVAFAAKheavy2249.1422750.72143+M+2751.3896 
VAQQVVDEVVLVNTDEICAAVK02568.3469 VAQQVVDEVVLVNTDEICAAVKlight2568.34691285.18072+M1285.1807 
VAQQVVDEVVLVNTDEICAAVK02568.3469 VAQQVVDEVVLVNTDEICAAVKlight2568.34691285.18072+M+11285.6822 
VAQQVVDEVVLVNTDEICAAVK02568.3469 VAQQVVDEVVLVNTDEICAAVKlight2568.34691285.18072+M+21286.1834 
VAQQVVDEVVLVNTDEICAAVK02568.3469 VAQQVVDEVVLVNTDEICAAVKheavy2577.37711289.69582+M1289.6958 
VAQQVVDEVVLVNTDEICAAVK02568.3469 VAQQVVDEVVLVNTDEICAAVKheavy2577.37711289.69582+M+11290.1972 
VAQQVVDEVVLVNTDEICAAVK02568.3469 VAQQVVDEVVLVNTDEICAAVKheavy2577.37711289.69582+M+21290.6984 
sp|P00931|TRP_YEAST Tryptophan synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP5 PE=1 SV=1
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
NVIAETGAGQHGVATATACAK02196.0957 NVIAETGAGQHGVATATACAKlight2196.0957733.03923+M733.0392 
NVIAETGAGQHGVATATACAK02196.0957 NVIAETGAGQHGVATATACAKlight2196.0957733.03923+M+1733.3735 
NVIAETGAGQHGVATATACAK02196.0957 NVIAETGAGQHGVATATACAKlight2196.0957733.03923+M+2733.7075 
NVIAETGAGQHGVATATACAK02196.0957 NVIAETGAGQHGVATATACAKheavy2205.1259736.04923+M736.0492 
NVIAETGAGQHGVATATACAK02196.0957 NVIAETGAGQHGVATATACAKheavy2205.1259736.04923+M+1736.3835 
NVIAETGAGQHGVATATACAK02196.0957 NVIAETGAGQHGVATATACAKheavy2205.1259736.04923+M+2736.7175 
LPDAVVACVGGGSNSTGMFSPFEHDTSVK03135.4641 LPDAVVACVGGGSNSTGMFSPFEHDTSVKlight3135.46411046.16203+M1046.1620 
LPDAVVACVGGGSNSTGMFSPFEHDTSVK03135.4641 LPDAVVACVGGGSNSTGMFSPFEHDTSVKlight3135.46411046.16203+M+11046.4963 
LPDAVVACVGGGSNSTGMFSPFEHDTSVK03135.4641 LPDAVVACVGGGSNSTGMFSPFEHDTSVKlight3135.46411046.16203+M+21046.8304 
LPDAVVACVGGGSNSTGMFSPFEHDTSVK03135.4641 LPDAVVACVGGGSNSTGMFSPFEHDTSVKheavy3144.49431049.17213+M1049.1721 
LPDAVVACVGGGSNSTGMFSPFEHDTSVK03135.4641 LPDAVVACVGGGSNSTGMFSPFEHDTSVKheavy3144.49431049.17213+M+11049.5063 
LPDAVVACVGGGSNSTGMFSPFEHDTSVK03135.4641 LPDAVVACVGGGSNSTGMFSPFEHDTSVKheavy3144.49431049.17213+M+21049.8404 
LLSQLEGIIPALESSHAVYGACELAK02938.5474 LLSQLEGIIPALESSHAVYGACELAKlight2938.5474980.52313+M980.5231 
LLSQLEGIIPALESSHAVYGACELAK02938.5474 LLSQLEGIIPALESSHAVYGACELAKlight2938.5474980.52313+M+1980.8574 
LLSQLEGIIPALESSHAVYGACELAK02938.5474 LLSQLEGIIPALESSHAVYGACELAKlight2938.5474980.52313+M+2981.1916 
LLSQLEGIIPALESSHAVYGACELAK02938.5474 LLSQLEGIIPALESSHAVYGACELAKheavy2947.5776983.53313+M983.5331 
LLSQLEGIIPALESSHAVYGACELAK02938.5474 LLSQLEGIIPALESSHAVYGACELAKheavy2947.5776983.53313+M+1983.8674 
LLSQLEGIIPALESSHAVYGACELAK02938.5474 LLSQLEGIIPALESSHAVYGACELAKheavy2947.5776983.53313+M+2984.2016 
sp|P00942|TPIS_YEAST Triosephosphate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPI1 PE=1 SV=2
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
LNTASIPENVEVVICPPATYLDYSVSLVK03360.7527 LNTASIPENVEVVICPPATYLDYSVSLVKlight3360.75271121.25823+M1121.2582 
LNTASIPENVEVVICPPATYLDYSVSLVK03360.7527 LNTASIPENVEVVICPPATYLDYSVSLVKlight3360.75271121.25823+M+11121.5925 
LNTASIPENVEVVICPPATYLDYSVSLVK03360.7527 LNTASIPENVEVVICPPATYLDYSVSLVKlight3360.75271121.25823+M+21121.9267 
LNTASIPENVEVVICPPATYLDYSVSLVK03360.7527 LNTASIPENVEVVICPPATYLDYSVSLVKheavy3369.78291124.26823+M1124.2682 
LNTASIPENVEVVICPPATYLDYSVSLVK03360.7527 LNTASIPENVEVVICPPATYLDYSVSLVKheavy3369.78291124.26823+M+11124.6025 
LNTASIPENVEVVICPPATYLDYSVSLVK03360.7527 LNTASIPENVEVVICPPATYLDYSVSLVKheavy3369.78291124.26823+M+21124.9367