Name: oxICAT_H2O2_21_44.zip (119 MB)   1 version
 
785 proteins, 978 peptides, 1,956 precursors, 5,534 transitions  -  12 replicates  -  Skyline (64-bit) 2.6.0.6709
Protein / LabelDescriptionProtein Note/Annotations 
sp|Q01532-2|BLH1_YEAST Isoform Cytoplasmic of Cysteine proteinase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAP3
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
YHESLMTHAMLITGCHVDETSK02729.2611 YHESLMTHAMLITGCHVDETSKlight4+683.32262729.2611328.2473 
YHESLMTHAMLITGCHVDETSK02729.2611 YHESLMTHAMLITGCHVDETSKheavy4+685.58012738.2913328.2473 
sp|P04819-2|DNLI1_YEAST Isoform Nuclear of DNA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC9
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
LVGEVEDALSSNNNDHYSSNIPYSEVCEVFNK03798.7319 LVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKlight3+1267.25123798.7319350.4365 
LVGEVEDALSSNNNDHYSSNIPYSEVCEVFNK03798.7319 LVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKheavy3+1270.26133807.7621350.4365 
DAFCQVPNYEIVINSCLEHGIMNLDK03418.6360 DAFCQVPNYEIVINSCLEHGIMNLDKlight3+1140.55263418.6360345.6220 
DAFCQVPNYEIVINSCLEHGIMNLDK03418.6360 DAFCQVPNYEIVINSCLEHGIMNLDKheavy3+1146.57273436.6964345.6220 
DYLEGVGDSLDLCVLGAYYGR02504.1893 DYLEGVGDSLDLCVLGAYYGRlight2+1253.10192504.1893340.4981 
DYLEGVGDSLDLCVLGAYYGR02504.1893 DYLEGVGDSLDLCVLGAYYGRheavy2+1257.61702513.2195340.4981 
sp|P38431-2|IF5_YEAST Isoform Short of Eukaryotic translation initiation factor 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF5
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
IGCVLAQCLFDEDIVNEIAEHNAFFTK03492.7058 IGCVLAQCLFDEDIVNEIAEHNAFFTKlight3+1165.24253492.7058346.5602 
IGCVLAQCLFDEDIVNEIAEHNAFFTK03492.7058 IGCVLAQCLFDEDIVNEIAEHNAFFTKheavy3+1171.26273510.7661346.5602 
sp|P00724-2|INV2_YEAST Isoform Intracellular of Invertase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUC2
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
LESAFANEGFLGYQYECPGLIEVPTEQDPSK03657.7185 LESAFANEGFLGYQYECPGLIEVPTEQDPSKlight3+1220.24683657.7185348.6504 
LESAFANEGFLGYQYECPGLIEVPTEQDPSK03657.7185 LESAFANEGFLGYQYECPGLIEVPTEQDPSKheavy3+1223.25683666.7487348.6504 
sp|P06208-2|LEU1_YEAST Isoform Cytoplasmic of 2-isopropylmalate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU4
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
WSYEFSPECFSDTPGEFAVEICEAVK03423.5315 WSYEFSPECFSDTPGEFAVEICEAVKlight3+1142.18453423.5315345.6840 
WSYEFSPECFSDTPGEFAVEICEAVK03423.5315 WSYEFSPECFSDTPGEFAVEICEAVKheavy3+1148.20463441.5919345.6840 
APYGGDLVVCAFSGSHQDAIK02361.1423 APYGGDLVVCAFSGSHQDAIKlight3+788.05472361.1423332.2271 
APYGGDLVVCAFSGSHQDAIK02361.1423 APYGGDLVVCAFSGSHQDAIKheavy3+791.06482370.1725332.2271 
sp|P15565-2|TRM1_YEAST Isoform 2 of tRNA (guanine(26)-N(2))-dimethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM1
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
CFALYGGANMVSHESTHESALR02606.2006 CFALYGGANMVSHESTHESALRlight3+869.74082606.2006335.3312 
CFALYGGANMVSHESTHESALR02606.2006 CFALYGGANMVSHESTHESALRheavy3+872.75092615.2308335.3312 
sp|P31383|2AAA_YEAST Protein phosphatase PP2A regulatory subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPD3 PE=1 SV=3
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
FSDLASQFSSNQAYIDELVQPFLNLCEDNEGDVR04089.8902 FSDLASQFSSNQAYIDELVQPFLNLCEDNEGDVRlight3+1364.30404089.8902354.1246 
FSDLASQFSSNQAYIDELVQPFLNLCEDNEGDVR04089.8902 FSDLASQFSSNQAYIDELVQPFLNLCEDNEGDVRheavy3+1367.31414098.9204354.1246 
sp|P38720|6PGD1_YEAST 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GND1 PE=1 SV=1
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
MVHNGIEYGDMQLICEAYDIMK02799.2740 MVHNGIEYGDMQLICEAYDIMKlight3+934.09862799.2740337.7767 
MVHNGIEYGDMQLICEAYDIMK02799.2740 MVHNGIEYGDMQLICEAYDIMKheavy3+937.10872808.3042337.7767 
sp|P12904|AAKG_YEAST 5'-AMP-activated protein kinase subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF4 PE=1 SV=1
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
ALGVDQLDTASIHPSRPLFEACLK02807.4640 ALGVDQLDTASIHPSRPLFEACLKlight3+936.82862807.4640237.8805 
ALGVDQLDTASIHPSRPLFEACLK02807.4640 ALGVDQLDTASIHPSRPLFEACLKheavy3+939.83872816.4942237.8805 
sp|Q08641|AB140_YEAST tRNA(Thr) (cytosine(32)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP140 PE=1 SV=3
PeptidePeptide Note/AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor Note/AnnotationsLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition CountCEDP
KDAEPVTIFEIGCGAGNTFFPILK12793.4411 KDAEPVTIFEIGCGAGNTFFPILKlight3+932.15432793.4411337.7029 
KDAEPVTIFEIGCGAGNTFFPILK12793.4411 KDAEPVTIFEIGCGAGNTFFPILKheavy3+935.16442802.4713337.7029