Protein / Label:sp|P02144|MYG_HUMAN
Description:Myoglobin OS=Homo sapiens GN=MB PE=1 SV=2
Decoy:false
Note: 
File:Set2_HL_Carolinas_sem pep ACAN_ncomm_2018-03-26_16-12-59.sky.zip
0102030405060708090
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKI
1
100110120130140150
PVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
1
DescriptionMyoglobin
Gene name(s)MB
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_976312.1
NP_976311.1
NP_005359.1
XP_005261662.1
none loaded Q5THY7
Q52H51
P02144
MYG_HUMAN
ENST00000406324
ENST00000397328
ENST00000397326
ENST00000359787
none loaded GO:0050873
GO:0043353
GO:0042542
GO:0031444
GO:0020037
GO:0019825
GO:0009725
GO:0007507
GO:0005506
GO:0005344
GO:0001666

Peak Areas

Retention Times