Protein / Label:sp|P09960|LKHA4_HUMAN
Description:Leukotriene A-4 hydrolase OS=Homo sapiens GN=LTA4H PE=1 SV=2
Decoy:false
Note: 
File:Set2_HL_Carolinas_sem pep ACAN_ncomm_2018-03-26_16-12-59.sky.zip
0102030405060708090
MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQE
100110120130140150160170180190
IVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPC
1
200210220230240250260270280290
YLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
300310320330340350360370380390
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGG
400410420430440450460470480490
PEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNATDLKDLSSHQL
<
500510520530540550560570580590
NEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
<< 1
600610
AMLVGKDLKVD
DescriptionLeukotriene A-4 hydrolase (short name: LTA-4 hydrolase)
Gene name(s)LTA4H
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_000886
NP_001243572.1
NP_000886.1
NP_001243573.1
XP_005268928.1
none loaded B4DVZ8
P09960-1
Q9UCT7
Q6IAT6
P09960
F8VV40
B4DNQ9
LKHA4_HUMAN
ENSP00000228740
ENST00000552789
ENST00000413268
ENST00000228740
IPI00219077
GO:0043171
GO:0019370
GO:0019369
GO:0008270
GO:0008237
GO:0006954
GO:0006508
GO:0005829
GO:0005634
GO:0004463
GO:0004301
GO:0004177

Peak Areas

Retention Times