Protein / Label:sp|P06756|ITAV_HUMAN
Description:Integrin alpha-V OS=Homo sapiens GN=ITGAV PE=1 SV=2
Decoy:false
Note: 
File:Set2_HL_Carolinas_sem pep ACAN_ncomm_2018-03-26_16-12-59.sky.zip
0102030405060708090
MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPI
100110120130140150160170180190
EFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVL
200210220230240250260270280290
LGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
300310320330340350360370380390
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKK
1
400410420430440450460470480490
GIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKV
1
500510520530540550560570580590
SCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
600610620630640650660670680690
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAF
1
700710720730740750760770780790
KTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEE
800810820830840850860870880890
DVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
900910920930940950960970980990
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILA
10001010102010301040
VLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
DescriptionIntegrin alpha-V
Gene name(s)ITGAV
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_002201.1
NP_001138471.1
NP_001138472.1
none loaded Q6LD15
Q59EB7
Q53SK4
P06756
E7EWZ6
D3DPG8
B7Z883
B0LPF4
A0AV67
ITAV_HUMAN
ENST00000433736
ENST00000374907
ENST00000261023
none loaded GO:2001237
GO:2000536
GO:2000425
GO:0097192
GO:0070371
GO:0052066
GO:0050900
GO:0050748
GO:0050431
GO:0046872
GO:0046718
GO:0045785
GO:0045715
GO:0045335
GO:0043277
GO:0035867
GO:0033690
GO:0032369
GO:0030335
GO:0030198
GO:0010888
GO:0010745
GO:0009986
GO:0009897
GO:0009615
GO:0008305
GO:0008284
GO:0007596
GO:0007411
GO:0007229
GO:0007160
GO:0005245
GO:0002479
GO:0001618
GO:0001525

Peak Areas

Retention Times