Protein / Label:sp|P12109|CO6A1_HUMAN
Description:Collagen alpha-1(VI) chain OS=Homo sapiens GN=COL6A1 PE=1 SV=3
Decoy:false
Note: 
File:Set2_HL_Carolinas_sem pep ACAN_ncomm_2018-03-26_16-12-59.sky.zip
0102030405060708090
MRAARALLPLLLQACWTAAQDEPETPRAVAFQDCPVDLFFVLDTSESVALRLKPYGALVDKVKSFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEII
100110120130140150160170180190
QGLTRMPGGRDALKSSVDAVKYFGKGTYTDCAIKKGLEQLLVGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAKHLGVKVFSVAITPDHLEPRL
1 <
200210220230240250260270280290
SIIATDHTYRRNFTAADWGQSRDAEEAISQTIDTIVDMIKNNVEQVCCSFECQPARGPPGLRGDPGFEGERGKPGLPGEKGEAGDPGRPGDLGPVGYQGM
<< 1
300310320330340350360370380390
KGEKGSRGEKGSRGPKGYKGEKGKRGIDGVDGVKGEMGYPGLPGCKGSPGFDGIQGPPGPKGDPGAFGLKGEKGEPGADGEAGRPGSSGPSGDEGQPGEP
400410420430440450460470480490
GPPGEKGEAGDEGNPGPDGAPGERGGPGERGPRGTPGTRGPRGDPGEAGPQGDQGREGPVGVPGDPGEAGPIGPKGYRGDEGPPGSEGARGAPGPAGPPG
500510520530540550560570580590
DPGLMGERGEDGPAGNGTEGFPGFPGYPGNRGAPGINGTKGYPGLKGDEGEAGDPGDDNNDIAPRGVKGAKGYRGPEGPQGPPGHQGPPGPDECEILDII
600610620630640650660670680690
MKMCSCCECKCGPIDLLFVLDSSESIGLQNFEIAKDFVVKVIDRLSRDELVKFEPGQSYAGVVQYSHSQMQEHVSLRSPSIRNVQELKEAIKSLQWMAGG
700710720730740750760770780790
TFTGEALQYTRDQLLPPSPNNRIALVITDGRSDTQRDTTPLNVLCSPGIQVVSVGIKDVFDFIPGSDQLNVISCQGLAPSQGRPGLSLVKENYAELLEDA
800810820830840850860870880890
FLKNVTAQICIDKKCPDYTCPITFSSPADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQYSGTGQQRPERASLQFLQNYTAL
900910920930940950960970980990
ASAVDAMDFINDATDVNDALGYVTRFYREASSGAAKKRLLLFSDGNSQGATPAAIEKAVQEAQRAGIEIFVVVVGRQVNEPHIRVLVTGKTAEYDVAYGE
1 >>
100010101020
SHLFRVPSYQALLRGVFHQTVSRKVALG
>
DescriptionCollagen alpha-1(VI) chain
Gene name(s)COL6A1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001839.2
none loaded Q9BSA8
Q7Z645
Q16258
Q14041
Q14040
P12109
O00118
O00117
CO6A1_HUMAN
ENST00000361866
none loaded GO:0071230
GO:0070208
GO:0048407
GO:0043234
GO:0042383
GO:0030574
GO:0022617
GO:0007411
GO:0007155
GO:0005788
GO:0005765
GO:0005589

Peak Areas

Retention Times