Protein / Label:sp|Q92597|NDRG1_HUMAN
Description:Protein NDRG1 OS=Homo sapiens GN=NDRG1 PE=1 SV=1
Decoy:false
Note: 
File:Set2_HL_Carolinas_sem pep ACAN_ncomm_2018-03-26_16-12-59.sky.zip
0102030405060708090
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQ
1
100110120130140150160170180190
DGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEE
200210220230240250260270280290
MQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAK
300310320330340350360370380390
LAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
1
DescriptionProtein NDRG1
Gene name(s)NDRG1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001128714.1
NP_006087.2
NP_001245362.1
XP_005250810.1
NP_001245361.1
none loaded Q9UK29
Q9NYR6
Q92597
Q6IBG2
O15207
B7Z446
B3KR80
NDRG1_HUMAN
ENST00000537882
ENST00000522476
ENST00000414097
ENST00000323851
none loaded GO:0090232
GO:0071456
GO:0055038
GO:0048471
GO:0045576
GO:0045296
GO:0043015
GO:0032287
GO:0030330
GO:0017137
GO:0010038
GO:0008017
GO:0005913
GO:0005886
GO:0005874
GO:0005829
GO:0005813
GO:0005634

Peak Areas

Retention Times