Protein / Label:sp|P00558|PGK1_HUMAN
Description:Phosphoglycerate kinase 1 OS=Homo sapiens GN=PGK1 PE=1 SV=3
Decoy:false
Note: 
File:Set2_HL_Carolinas_sem pep ACAN_ncomm_2018-03-26_16-12-59.sky.zip
0102030405060708090
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCV
100110120130140150160170180190
GPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKA
200210220230240250260270280290
LESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQ
1
300310320330340350360370380390
ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASL
400410
ELLEGKVLPGVDALSNI
1
DescriptionPhosphoglycerate kinase 1
Gene name(s)PGK1
Organisms Pan troglodytes

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001129210.1
none loaded P00558
A5A6K4
PGK1_HUMAN
PGK1_PANTR
none loaded none loaded GO:0006096
GO:0005737
GO:0005524
GO:0004618

Peak Areas

Retention Times