Protein / Label:AT2G05100.1
Description:| Symbols: LHCB2.1, LHCB2 | photosystem II light harvesting complex gene 2.1 | chr2:1823449-1824331 REVERSE LENGTH=265
Decoy:false
Note: 
File:psb33_vs_WT_thylakoid_proteins_ratios.sky.zip
0102030405060708090
MATSAIQQSSFAGQTALKPSNELLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGPFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVI
1 <
100110120130140150160170180190
HSRWAMLGALGCTFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGGPLGEGLDPLYPGGAFDPLNLA
<< 1
200210220230240250260
EDPEAFSELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANNAWSYATNFVPGN
Description| Symbols: LHCB2.1, LHCB2 | photosystem II light harvesting complex gene 2.1 | chr2:1823449-1824331 REVERSE LENGTH=265
Gene name(s)
Organisms Unknown unknown

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded none loaded none loaded none loaded none loaded none loaded

Peak Areas

Retention Times