Protein / Label:AT1G29910.1
Description:| Symbols: CAB3, AB180, LHCB1.2 | chlorophyll A/B binding protein 3 | chr1:10472443-10473246 REVERSE LENGTH=267
Decoy:false
Note: 
File:psb33_vs_WT_thylakoid_proteins_ratios.sky.zip
0102030405060708090
MAASTMALSSPAFAGKAVNLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEV
2 1 1 >>
1 >>
<
100110120130140150160170180190
IHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLG
> 1
> 1
<< 1
200210220230240250260
LATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK
DescriptionChlorophyll a-b binding protein 2, chloroplastic
Gene name(s)LHCB1.1, LHCB1.2
Organisms Arabidopsis thaliana

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_564340.1
NP_564339.1
none loaded P0CJ48
Q8VZ87
P83754
P04777
CB1A_ARATH
CB1B_ARATH
none loaded none loaded GO:0048046
GO:0010218
GO:0010114
GO:0009750
GO:0009637
GO:0046872
GO:0018298
GO:0016168
GO:0016021
GO:0010287
GO:0009765
GO:0009535
GO:0009523
GO:0009522
GO:0005739

Peak Areas

Retention Times