Protein / Label:AT1G71500.1
Description:| Symbols: | Rieske (2Fe-2S) domain-containing protein | chr1:26936084-26937331 FORWARD LENGTH=287
Decoy:false
Note: 
File:psb33_vs_WT_thylakoid_proteins_ratios.sky.zip
0102030405060708090
MATTASSSLPRNYSFTTPRPSSFIRGPPLARTLPLYLRRNRRVALTYRLDQNSKQRSGGNVRCEATEVSSSSSVSTPGRNWVPVVPLSALPKGERRVVIQ
100110120130140150160170180190
DDETILLLWYKNDVFAIENRSPAEGAYSEGLLNARLTQDGCIVCPSTDSTFDLRTGEIREWYPKNPVLRVLTPALRKLFVYPVKYDEENIYISIRDSGKT
1 <
200210220230240250260270280
EAAAEIVFSGKAQPGLTATNVNVDEVRMIVDEGSEGFGFTKKNEVINGKAAVIGFLLLLDFELLTGKGLLKGTGFLDFLYSASDAFK
<< 1 1
Description| Symbols: | Rieske (2Fe-2S) domain-containing protein | chr1:26936084-26937331 FORWARD LENGTH=287
Gene name(s)
Organisms Unknown unknown

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded none loaded none loaded none loaded none loaded none loaded

Peak Areas

Retention Times