Protein / Label:AT4G27800.1
Description:| Symbols: TAP38, PPH1 | thylakoid-associated phosphatase 38 | chr4:13852013-13854091 REVERSE LENGTH=388
Decoy:false
Note: 
File:psb33_vs_WT_thylakoid_proteins_ratios.sky.zip
0102030405060708090
MALLRPHLHRFHSNTLRHSAYPSADAGGGLVVYPTYGRHRCSAIAIDAPSSLTGVTPIRWGYTSVQGFRDEMEDDIVIRSDAVDSFSYAAVFDGHAGSSS
100110120130140150160170180190
VKFLREELYKECVGALQAGSLLNGGDFAAIKEALIKAFESVDRNLLKWLEANGDEEDESGSTATVMIIRNDVSFIAHIGDSCAVLSRSGQIEELTDYHRP
1
200210220230240250260270280290
YGSSRAAIQEVKRVKEAGGWIVNGRICGDIAVSRAFGDIRFKTKKNDMLKKGVDEGRWSEKFVSRIEFKGDMVVATPDIFQVPLTSDVEFIILASDGLWD
300310320330340350360370380
YMKSSDVVSYVRDQLRKHGNVQLACESLAQVALDRRSQDNISIIIADLGRTEWKNLPAQRQNVVVELVQAATTIGLVTVGIWMSSHLS
1 1
DescriptionProtein phosphatase 2C 57 (short name: AtPP2C57)
Gene name(s)PPH1
Organisms Arabidopsis thaliana

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_194509.1
NP_849459.1
NP_849460.1
none loaded Q9STP6
Q9M0J6
Q3E9V4
Q3E9V3
P49599
P2C57_ARATH
none loaded none loaded GO:0080005
GO:0046872
GO:0016791
GO:0016021
GO:0009767
GO:0009579
GO:0009570
GO:0006470
GO:0005730
GO:0004722

Peak Areas

Retention Times