Protein / Label:AT5G01920.1
Description:| Symbols: STN8 | Protein kinase superfamily protein | chr5:359154-360867 FORWARD LENGTH=495
Decoy:false
Note: 
File:psb33_vs_WT_thylakoid_proteins_ratios.sky.zip
0102030405060708090
MASLLSPATPTATSAAFHSCSTAGFSTPTHISSQNSSLSLLSRRGCMMRCSFSPQDIPVDSLSHLPPFLDFQNSLATFSDTQKWGFFVSAGIVWFYLTAR
100110120130140150160170180190
PGVLIGAIDAYLLAPLQLGLDTLIGRRLKRSDFLVTEKLGEGSFGVVYAGVLLPKNSTLVDDVRVSKARAKAMDFTGEFKQRVILKKVKVGVRGAEEFGE
1
200210220230240250260270280290
YEEWFNYRLSRAAPDTCAEFLGSFVADKTNTMFTKGGKWLVWRFEGDRDLADYMKDRSFPSNLESIMFGRVLQGVESVKRRALIIKQIMRQIITSLRKIH
300310320330340350360370380390
GTGIVHRDVKPANLVVTKKGQIKLIDFGAAADLRIGKNYIPERTLLDPDYCPPELYVLPEETPSPPPEPIAALLSPILWQLNSPDLFDMYSAGIVLLQMA
1
400410420430440450460470480490
VPTLRSTAGLKNFNLEIKSVEYDLNRWRERTRTRPDLSILDLDSGRGWDLVTKLISERGSLRRGRLSAAAALRHPYFLLGGDQAAAVLSKLSFSK
1
DescriptionSerine/threonine-protein kinase STN8, chloroplastic
Gene name(s)STN8
Organisms Arabidopsis thaliana

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_195812.1
none loaded Q9LZV4
Q8GZ98
STN8_ARATH
none loaded none loaded GO:0042549
GO:0009579
GO:0009534
GO:0009507
GO:0005524
GO:0004674
GO:0004672

Peak Areas

Retention Times