Protein / Label:AT1G68830.1
Description:| Symbols: STN7 | STT7 homolog STN7 | chr1:25872654-25875473 REVERSE LENGTH=562
Decoy:false
Note: 
File:psb33_vs_WT_thylakoid_proteins_ratios.sky.zip
0102030405060708090
MATISPGGAYIGTPSPFLGKKLKPFSLTSPILSFKPTVKLNSSCRAQLIDTVHNLFIGVGVGLPCTVMECGDMIYRSTLPKSNGLTITAPGVALALTALS
100110120130140150160170180190
YLWATPGVAPGFFDMFVLAFVERLFRPTFRKDDFVVGKKLGEGSFGVVYKVSLSKKRSNEEGEYVLKKATEYGAVEIWMNERVRRACGNSCADFVYGFLD
1
200210220230240250260270280290
KSSKKGPEYWLLWKYEGESTLAGLMQSKEFPYNVETIILGKVQDLPKGLERENKIIQTIMRQLLFALDGLHSTGIIHRDVKPQNIIFSEGSRSFKIIDLG
300310320330340350360370380390
AAADLRVGINYIPKEFLLDPRYAAPEQYIMSTQTPSAPSAPVAAALSPVLWQMNLPDRFDIYSIGLIFLQMAFPSLRSDSNLIQFNRQLKRCDYDLTAWR
1
400410420430440450460470480490
KLVEPRASADLRRGFELVDLDGGIGWELLTSMVRYKARQRISAKAALAHPYFDRQGLLALSVMQNLRMQYFRATQQDYSEAANWVIQLMAKNGTEKDGGF
<
500510520530540550560
TETQLQELREKEPRKKANAQRNALASALRLQRKLVKTVTETIDEISDGRKTVWWNRWIPREE
<< 1
DescriptionSerine/threonine-protein kinase STN7, chloroplastic
Gene name(s)STN7
Organisms Arabidopsis thaliana

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_564946.1
none loaded Q9S713
Q56WW0
A4FVQ4
STT7_ARATH
none loaded none loaded GO:0042548
GO:0009535
GO:0009507
GO:0007623
GO:0005524
GO:0004674
GO:0004672

Peak Areas

Retention Times