Protein / Label:ATCG00340.1
Description:| Symbols: PSAB | Photosystem I, PsaA/PsaB protein | chrC:37375-39579 REVERSE LENGTH=734
Decoy:false
Note: 
File:psb33_vs_WT_thylakoid_proteins_ratios.sky.zip
0102030405060708090
MALRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFETWVQDPLHVRPIAHAIWDPHFGQPA
100110120130140150160170180190
VEAFTRGGALGPVNIAYSGVYQWWYTIGLRTNEDLYTGALFLLFLSALSLIGGWLHLQPKWKPRVSWFKNAESRLNHHLSGLFGVSSLAWTGHLVHVAIP
200210220230240250260270280290
ASRGEYVRWNNFLNVLPHPQGLGPLFTGQWNLYAQNPDSSSHLFGTSQGSGTAILTLLGGFHPQTQSLWLTDMAHHHLAIAILFLIAGHMYRTNFGIGHS
300310320330340350360370380390
IKDLLEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNP
400410420430440450460470480490
EQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTSGPAFNAGRSIWLPGWLNA
1 1
500510520530540550560570580590
INENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHIT
600610620630640650660670680690
LWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWKDKPVAL
1
700710720730
SIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFG
DescriptionPhotosystem I P700 chlorophyll a apoprotein A2
Gene name(s)psaB
Organisms Arabidopsis thaliana

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_051058.1
none loaded P56767
PSAB_ARATH
none loaded none loaded GO:0051539
GO:0018298
GO:0016491
GO:0016168
GO:0016021
GO:0015979
GO:0009535
GO:0009522
GO:0009055
GO:0000287

Peak Areas

Retention Times