Protein / Label:ATCG00680.1
Description:| Symbols: PSBB | photosystem II reaction center protein B | chrC:72371-73897 FORWARD LENGTH=508
Decoy:false
Note: 
File:psb33_vs_WT_thylakoid_proteins_ratios.sky.zip
0102030405060708090
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAH
100110120130140150160170180190
IVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQPVNPAWGVEGFDPFVPGGIAS
200210220230240250260270280290
HHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE
1 >>
1 >>
300310320330340350360370380390
AWAKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVE
> 1
> 1
1
400410420430440450460470480490
FYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFAGIDPDLDAQVEFGAFQKLGD
1
1
1
500
PTTKRQAV
DescriptionPhotosystem II CP47 chlorophyll apoprotein
Gene name(s)psbB
Organisms Arabidopsis thaliana

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_051084.1
none loaded P56777
PSBB_ARATH
none loaded none loaded GO:0018298
GO:0016168
GO:0016021
GO:0009767
GO:0009535
GO:0009523

Peak Areas

Retention Times