Protein / Label:ATCG00270.1
Description:| Symbols: PSBD | photosystem II reaction center protein D | chrC:32711-33772 FORWARD LENGTH=353
Decoy:false
Note: 
File:psb33_vs_WT_thylakoid_proteins_ratios.sky.zip
0102030405060708090
MTIALGKFTKDEKDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQG
100110120130140150160170180190
DFTRWCQLGGLWAFVALHGAFALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMM
200210220230240250260270280290
GVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV
1 >>
300310320330340350
SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
> 1
1
1
DescriptionPhotosystem II D2 protein (short name: PSII D2 protein)
Gene name(s)psbD
Organisms Draba nemorosa

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
YP_001123545.1
none loaded A4QL14
PSBD_DRANE
none loaded none loaded GO:0045156
GO:0016491
GO:0016021
GO:0009772
GO:0009535
GO:0009523
GO:0005506

Peak Areas

Retention Times