iPRG_10ppm_2rt_95cut_nosingle_2016-08-03_04-44-06.sky.zip

iPRG 2015
Name: iPRG_10ppm_2rt_95cut_nosingle_2016-08-03_04-44-06.sky.zip (3 GB)   1 version
 
Protein / LabelDescriptionProtein Annotations 
DECOY_sp|P40368|NUP82_YEAST Decoy sequence
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
IDNLLLNK0941.5546 IDNLLLNKlight941.5546471.78462+M471.7846 
IDNLLLNK0941.5546 IDNLLLNKlight941.5546471.78462+M+1472.2860 
IDNLLLNK0941.5546 IDNLLLNKlight941.5546471.78462+M+2472.7874 
STVLVSMEVDISTYLDK01914.9496 STVLVSMEVDISTYLDKlight1914.9496639.32383+M639.3238 
STVLVSMEVDISTYLDK01914.9496 STVLVSMEVDISTYLDKlight1914.9496639.32383+M+1639.6581 
STVLVSMEVDISTYLDK01914.9496 STVLVSMEVDISTYLDKlight1914.9496639.32383+M+2639.9922 
DECOY_sp|Q08234|YO075_YEAST Decoy sequence
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
LQVTVTR0815.4865 LQVTVTRlight815.4865408.75052+M408.7505 
LQVTVTR0815.4865 LQVTVTRlight815.4865408.75052+M+1409.2519 
LQVTVTR0815.4865 LQVTVTRlight815.4865408.75052+M+2409.7532 
LELDDIR0872.4603 LELDDIRlight872.4603437.23752+M437.2375 
LELDDIR0872.4603 LELDDIRlight872.4603437.23752+M+1437.7389 
LELDDIR0872.4603 LELDDIRlight872.4603437.23752+M+2438.2402 
sp|D6VTK4|STE2_YEAST Pheromone alpha factor receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE2 PE=1 SV=2
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
TNTITSDFTTSTDR01558.7111 TNTITSDFTTSTDRlight1558.7111780.36282+M780.3628 
TNTITSDFTTSTDR01558.7111 TNTITSDFTTSTDRlight1558.7111780.36282+M+1780.8643 
TNTITSDFTTSTDR01558.7111 TNTITSDFTTSTDRlight1558.7111780.36282+M+2781.3656 
FYPGTLSSFQTDSINNDAK02103.9749 FYPGTLSSFQTDSINNDAKlight2103.97491052.99472+M1052.9947 
FYPGTLSSFQTDSINNDAK02103.9749 FYPGTLSSFQTDSINNDAKlight2103.97491052.99472+M+11053.4962 
FYPGTLSSFQTDSINNDAK02103.9749 FYPGTLSSFQTDSINNDAKlight2103.97491052.99472+M+21053.9976 
TFVSETADDIEK01353.6300 TFVSETADDIEKlight1353.6300677.82232+M677.8223 
TFVSETADDIEK01353.6300 TFVSETADDIEKlight1353.6300677.82232+M+1678.3238 
TFVSETADDIEK01353.6300 TFVSETADDIEKlight1353.6300677.82232+M+2678.8251 
NQFYQLPTPTSSK01509.7464 NQFYQLPTPTSSKlight1509.7464755.88052+M755.8805 
NQFYQLPTPTSSK01509.7464 NQFYQLPTPTSSKlight1509.7464755.88052+M+1756.3819 
NQFYQLPTPTSSK01509.7464 NQFYQLPTPTSSKlight1509.7464755.88052+M+2756.8833 
IGPFADASYK01067.5288 IGPFADASYKlight1067.5288534.77172+M534.7717 
IGPFADASYK01067.5288 IGPFADASYKlight1067.5288534.77172+M+1535.2732 
IGPFADASYK01067.5288 IGPFADASYKlight1067.5288534.77172+M+2535.7745 
EGEVEPVDMYTPDTAADEEARK12451.0748 EGEVEPVDMYTPDTAADEEARKlight2451.0748818.03223+M818.0322 
EGEVEPVDMYTPDTAADEEARK12451.0748 EGEVEPVDMYTPDTAADEEARKlight2451.0748818.03223+M+1818.3665 
EGEVEPVDMYTPDTAADEEARK12451.0748 EGEVEPVDMYTPDTAADEEARKlight2451.0748818.03223+M+2818.7006 
sp|O13297|CET1_YEAST mRNA-capping enzyme subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CET1 PE=1 SV=2
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
LSEAANGSRPFAENLESDINQTETGQAAPIDNYK03649.7132 LSEAANGSRPFAENLESDINQTETGQAAPIDNYKlight3649.71321217.57843+M1217.5784 
LSEAANGSRPFAENLESDINQTETGQAAPIDNYK03649.7132 LSEAANGSRPFAENLESDINQTETGQAAPIDNYKlight3649.71321217.57843+M+11217.9126 
LSEAANGSRPFAENLESDINQTETGQAAPIDNYK03649.7132 LSEAANGSRPFAENLESDINQTETGQAAPIDNYKlight3649.71321217.57843+M+21218.2469 
NLLSNGSPPMNDGSDANAK01900.8585 NLLSNGSPPMNDGSDANAKlight1900.8585951.43652+M951.4365 
NLLSNGSPPMNDGSDANAK01900.8585 NLLSNGSPPMNDGSDANAKlight1900.8585951.43652+M+1951.9379 
NLLSNGSPPMNDGSDANAK01900.8585 NLLSNGSPPMNDGSDANAKlight1900.8585951.43652+M+2952.4389 
QGNEGNIASNYITQVPLQK02073.0491 QGNEGNIASNYITQVPLQKlight2073.04911037.53182+M1037.5318 
QGNEGNIASNYITQVPLQK02073.0491 QGNEGNIASNYITQVPLQKlight2073.04911037.53182+M+11038.0333 
QGNEGNIASNYITQVPLQK02073.0491 QGNEGNIASNYITQVPLQKlight2073.04911037.53182+M+21038.5346 
IAGNAVGSVVK01013.5869 IAGNAVGSVVKlight1013.5869507.80072+M507.8007 
IAGNAVGSVVK01013.5869 IAGNAVGSVVKlight1013.5869507.80072+M+1508.3022 
IAGNAVGSVVK01013.5869 IAGNAVGSVVKlight1013.5869507.80072+M+2508.8035 
ALQSINVK0871.5127 ALQSINVKlight871.5127436.76362+M436.7636 
ALQSINVK0871.5127 ALQSINVKlight871.5127436.76362+M+1437.2651 
ALQSINVK0871.5127 ALQSINVKlight871.5127436.76362+M+2437.7664 
IDPSFLNIIPDDDLTK01814.9302 IDPSFLNIIPDDDLTKlight1814.9302908.47242+M908.4724 
IDPSFLNIIPDDDLTK01814.9302 IDPSFLNIIPDDDLTKlight1814.9302908.47242+M+1908.9739 
IDPSFLNIIPDDDLTK01814.9302 IDPSFLNIIPDDDLTKlight1814.9302908.47242+M+2909.4753 
GISEVTENTGK01133.5564 GISEVTENTGKlight1133.5564567.78552+M567.7855 
GISEVTENTGK01133.5564 GISEVTENTGKlight1133.5564567.78552+M+1568.2869 
GISEVTENTGK01133.5564 GISEVTENTGKlight1133.5564567.78552+M+2568.7882 
FSIIESQTR01079.5611 FSIIESQTRlight1079.5611540.78782+M540.7878 
FSIIESQTR01079.5611 FSIIESQTRlight1079.5611540.78782+M+1541.2893 
FSIIESQTR01079.5611 FSIIESQTRlight1079.5611540.78782+M+2541.7906 
VGLSTQRPR01012.5778 VGLSTQRPRlight1012.5778338.53323+M338.5332 
VGLSTQRPR01012.5778 VGLSTQRPRlight1012.5778338.53323+M+1338.8674 
VGLSTQRPR01012.5778 VGLSTQRPRlight1012.5778338.53323+M+2339.2016 
ISLNLELPVPDNDPPEK01888.9782 ISLNLELPVPDNDPPEKlight1888.9782945.49642+M945.4964 
ISLNLELPVPDNDPPEK01888.9782 ISLNLELPVPDNDPPEKlight1888.9782945.49642+M+1945.9979 
ISLNLELPVPDNDPPEK01888.9782 ISLNLELPVPDNDPPEKlight1888.9782945.49642+M+2946.4993 
SQSPISER0902.4458 SQSPISERlight902.4458452.23022+M452.2302 
SQSPISER0902.4458 SQSPISERlight902.4458452.23022+M+1452.7316 
SQSPISER0902.4458 SQSPISERlight902.4458452.23022+M+2453.2328 
TFLNNGTIIR01147.6350 TFLNNGTIIRlight1147.6350574.82482+M574.8248 
TFLNNGTIIR01147.6350 TFLNNGTIIRlight1147.6350574.82482+M+1575.3262 
TFLNNGTIIR01147.6350 TFLNNGTIIRlight1147.6350574.82482+M+2575.8275 
LSSLSYEIFEGSK01458.7242 LSSLSYEIFEGSKlight1458.7242730.36942+M730.3694 
LSSLSYEIFEGSK01458.7242 LSSLSYEIFEGSKlight1458.7242730.36942+M+1730.8709 
LSSLSYEIFEGSK01458.7242 LSSLSYEIFEGSKlight1458.7242730.36942+M+2731.3723 
sp|O13329|FOB1_YEAST DNA replication fork-blocking protein FOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOB1 PE=1 SV=2
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
ETPIFLESLTR01304.6976 ETPIFLESLTRlight1304.6976653.35612+M653.3561 
ETPIFLESLTR01304.6976 ETPIFLESLTRlight1304.6976653.35612+M+1653.8576 
ETPIFLESLTR01304.6976 ETPIFLESLTRlight1304.6976653.35612+M+2654.3589 
SLTADTLQQISDK01418.7253 SLTADTLQQISDKlight1418.7253710.36992+M710.3699 
SLTADTLQQISDK01418.7253 SLTADTLQQISDKlight1418.7253710.36992+M+1710.8714 
SLTADTLQQISDK01418.7253 SLTADTLQQISDKlight1418.7253710.36992+M+2711.3727 
sp|O13539|THP2_YEAST THO complex subunit THP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THP2 PE=1 SV=1
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
SSDDLLTESLK01206.5980 SSDDLLTESLKlight1206.5980604.30632+M604.3063 
SSDDLLTESLK01206.5980 SSDDLLTESLKlight1206.5980604.30632+M+1604.8077 
SSDDLLTESLK01206.5980 SSDDLLTESLKlight1206.5980604.30632+M+2605.3091 
EAQLLEDTK01045.5292 EAQLLEDTKlight1045.5292523.77192+M523.7719 
EAQLLEDTK01045.5292 EAQLLEDTKlight1045.5292523.77192+M+1524.2733 
EAQLLEDTK01045.5292 EAQLLEDTKlight1045.5292523.77192+M+2524.7746 
sp|O13547|CCW14_YEAST Covalently-linked cell wall protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCW14 PE=1 SV=1
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
SSSTCDSLNQVTCYCEHENSAVK02675.0898 SSSTCDSLNQVTCYCEHENSAVKlight2675.0898892.70393+M892.7039 
SSSTCDSLNQVTCYCEHENSAVK02675.0898 SSSTCDSLNQVTCYCEHENSAVKlight2675.0898892.70393+M+1893.0381 
SSSTCDSLNQVTCYCEHENSAVK02675.0898 SSSTCDSLNQVTCYCEHENSAVKlight2675.0898892.70393+M+2893.3720 
CLDSICPNNDADAAYSAFK02130.8987 CLDSICPNNDADAAYSAFKlight2130.89871066.45662+M1066.4566 
CLDSICPNNDADAAYSAFK02130.8987 CLDSICPNNDADAAYSAFKlight2130.89871066.45662+M+11066.9580 
CLDSICPNNDADAAYSAFK02130.8987 CLDSICPNNDADAAYSAFKlight2130.89871066.45662+M+21067.4588 
sp|O13563|RPN13_YEAST 26S proteasome regulatory subunit RPN13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN13 PE=1 SV=1
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
AGVCEYNEDSR01298.5197 AGVCEYNEDSRlight1298.5197650.26712+M650.2671 
AGVCEYNEDSR01298.5197 AGVCEYNEDSRlight1298.5197650.26712+M+1650.7685 
AGVCEYNEDSR01298.5197 AGVCEYNEDSRlight1298.5197650.26712+M+2651.2691 
IFALVFSSNER01281.6717 IFALVFSSNERlight1281.6717641.84312+M641.8431 
IFALVFSSNER01281.6717 IFALVFSSNERlight1281.6717641.84312+M+1642.3446 
IFALVFSSNER01281.6717 IFALVFSSNERlight1281.6717641.84312+M+2642.8460 
YFFWLQEK01159.5702 YFFWLQEKlight1159.5702580.79242+M580.7924 
YFFWLQEK01159.5702 YFFWLQEKlight1159.5702580.79242+M+1581.2939 
YFFWLQEK01159.5702 YFFWLQEKlight1159.5702580.79242+M+2581.7953 
NSGNLPLNELSAK01355.7045 NSGNLPLNELSAKlight1355.7045678.85952+M678.8595 
NSGNLPLNELSAK01355.7045 NSGNLPLNELSAKlight1355.7045678.85952+M+1679.3610 
NSGNLPLNELSAK01355.7045 NSGNLPLNELSAKlight1355.7045678.85952+M+2679.8623 
sp|O13585|YP089_YEAST Dilute domain-containing protein YPR089W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR089W PE=1 SV=2
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
HEIPQISQPK01175.6299 HEIPQISQPKlight1175.6299588.82222+M588.8222 
HEIPQISQPK01175.6299 HEIPQISQPKlight1175.6299588.82222+M+1589.3237 
HEIPQISQPK01175.6299 HEIPQISQPKlight1175.6299588.82222+M+2589.8250 
DVGEIDLSDPILR01440.7460 DVGEIDLSDPILRlight1440.7460721.38032+M721.3803 
DVGEIDLSDPILR01440.7460 DVGEIDLSDPILRlight1440.7460721.38032+M+1721.8818 
DVGEIDLSDPILR01440.7460 DVGEIDLSDPILRlight1440.7460721.38032+M+2722.3831 
NVATYKPIDENNK01504.7522 NVATYKPIDENNKlight1504.7522753.38342+M753.3834 
NVATYKPIDENNK01504.7522 NVATYKPIDENNKlight1504.7522753.38342+M+1753.8848 
NVATYKPIDENNK01504.7522 NVATYKPIDENNKlight1504.7522753.38342+M+2754.3862 
ITPVQLLK0910.5852 ITPVQLLKlight910.5852456.29992+M456.2999 
ITPVQLLK0910.5852 ITPVQLLKlight910.5852456.29992+M+1456.8013 
ITPVQLLK0910.5852 ITPVQLLKlight910.5852456.29992+M+2457.3027 
sp|O14455|RL36B_YEAST 60S ribosomal protein L36-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL36B PE=1 SV=3
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
VTQMTPAPK0971.5110 VTQMTPAPKlight971.5110486.76282+M486.7628 
VTQMTPAPK0971.5110 VTQMTPAPKlight971.5110486.76282+M+1487.2642 
VTQMTPAPK0971.5110 VTQMTPAPKlight971.5110486.76282+M+2487.7645 
VTQMTPAPK0987.5059 VTQMTPAPKlight987.5059494.76022+M494.7602 
VTQMTPAPK0987.5059 VTQMTPAPKlight987.5059494.76022+M+1495.2617 
VTQMTPAPK0987.5059 VTQMTPAPKlight987.5059494.76022+M+2495.7619