Protein / Label:sll0247
Description:iron-stress chlorophyll-binding protein, homologous to psbC (CP43)
Decoy:false
Note: 
File:dIsaR1_2016-10-17_12-45-32.sky.zip
0102030405060708090
MQTYGNDTVQYEWWAGNARFADQSGLFIAAHVAQAALTAFWAGAFTLFEISRFDPTQAMGDQGLILLPHLATLGWGVGDGGQIVDTYPYFVIGSIHLIAS
100110120130140150160170180190
AVLGAGALFHTLRAPADLSTLKGQGKKFHFTWENPQQLGIILGHHLLFLGAGALLLAGKAMYWGGLYDATTQTVRLVSQPTLDPLVIYGYQTHFASISSL
1
200210220230240250260270280290
EDLVGGHIFVGFLLIGGGIWHILVPPLGWAKKVLLFSGEAILSYSLGGIALAGFVAAYFCAVNTLAYPPEFYGPPLAIKLGIFPYFADTVELPMHAHTSR
300310320330340
AWLANAHFFLAFFFLQGHLWHALRALGFDFKRVEQAFDSLQT
1
DescriptionIron stress-induced chlorophyll-binding protein
Gene name(s)isiA
Organisms

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
YP_007451150.1
NP_441268.1
YP_005651325.1
none loaded Q55274
P73884
ISIA_SYNY3
none loaded none loaded GO:0042651
GO:0030094
GO:0018298
GO:0016168
GO:0016021
GO:0010106
GO:0009767

Peak Areas

Retention Times