Protein / Label:sp|P35821|PTN1_MOUSE
Description:Tyrosine-protein phosphatase non-receptor type 1 OS=Mus musculus GN=Ptpn1 PE=1 SV=2
Decoy:false
Note: 
File:Gadd45a_mouse_Suppl Spectral Viewer_v1_2016-05-22_15-58-51.sky.zip
0102030405060708090
MEMEKEFEEIDKAGNWAAIYQDIRHEASDFPCKVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVW
100110120130140150160170180190
EQKSRGVVMLNRIMEKGSLKCAQYWPQQEEKEMVFDDTGLKLTLISEDVKSYYTVRQLELENLTTKETREILHFHYTTWPDFGVPESPASFLNFLFKVRE
200210220230240250260270280290
SGSLSLEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSREDLD
1
300310320330340350360370380390
LPPEHVPPPPRPPKRTLEPHNGKCKELFSSHQWVSEETCGDEDSLAREEGRAQSSAMHSVSSMSPDTEVRRRMVGGGLQSAQASVPTEEELSSTEEEHKA
400410420430
HWPSHWKPFLVNVCMATLLATGAYLCYRVCFH
DescriptionTyrosine-protein phosphatase non-receptor type 1
Gene name(s)Ptpn1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_035331.3
none loaded Q3TZW9
Q99JS1
Q64498
Q62131
Q60840
P35821
Q3TZW9_MOUSE
PTN1_MOUSE
ENSMUST00000029053
none loaded GO:1902202
GO:0046626
GO:0035791
GO:0031532
GO:0031410
GO:0030968
GO:0030100
GO:0009966
GO:0008286
GO:0008270
GO:0005886
GO:0005829
GO:0005789
GO:0005769
GO:0004725

Peak Areas

Retention Times