Protein / Label:sp|Q9D358|PPAC_MOUSE
Description:Low molecular weight phosphotyrosine protein phosphatase OS=Mus musculus GN=Acp1 PE=2 SV=3
Decoy:false
Note: 
File:Gadd45a_mouse_Suppl Spectral Viewer_v1_2016-05-22_15-58-51.sky.zip
0102030405060708090
MAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWRIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHIARQITKEDFATFDYILCMDESNLRDL
1
100110120130140150
NRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY
DescriptionLow molecular weight phosphotyrosine protein phosphatase (short name: LMW-PTP)
Gene name(s)Acp1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_067305.2
XP_003945900.1
NP_001103709.1
none loaded Q9QWF5
Q9D358
O88740
O88739
PPAC_MOUSE
ENSMUST00000062740
none loaded GO:0035335
GO:0009898
GO:0005737
GO:0005634
GO:0004726
GO:0003993

Peak Areas

Retention Times