Protein / Label:sp|Q91WB2|PPAC3_MOUSE
Description:Probable lipid phosphate phosphatase PPAPDC3 OS=Mus musculus GN=Ppapdc3 PE=1 SV=1
Decoy:false
Note: 
File:Gadd45a_mouse_Suppl Spectral Viewer_v1_2016-05-22_15-58-51.sky.zip
0102030405060708090
MPASQSRARARDRNNVLNRAEFLSLNQPPKGTQEPRSSGRKASGPSTQPPPSSDGARERRQSQQLPEEDCMQLNPSFKGIAFNSLLAIDICMSKRLGVCA
1
100110120130140150160170180190
GRAASWASARSMVKLIGITGHGIPWIGGTILCLVRSSTLAGQEVLMNLLLALLLDIMTVAGVQKLIKRRGPYETSPGLLDYLTMDIYAFPAGHASRAAMV
200210220230240250260270
SKFFLSHLVLAVPLRVLLVLWAFCVGLSRVMIGRHHITDVISGFIIGYFQFRLVELVWMSSNTCQMLISAW
DescriptionProbable lipid phosphate phosphatase PPAPDC3
Gene name(s)Ppapdc3
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_663496.1
none loaded Q91WB2
PPAC3_MOUSE
ENSMUST00000057423
none loaded GO:0016787
GO:0016021
GO:0010832
GO:0008152
GO:0005789
GO:0005635

Peak Areas

Retention Times