Protein / Label:sp|P07934|PHKG1_MOUSE
Description:Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform OS=Mus musculus GN=Phkg1 PE=2 SV=3
Decoy:false
Note: 
File:Gadd45a_mouse_Suppl Spectral Viewer_v1_2016-05-22_15-58-51.sky.zip
0102030405060708090
MTRDDALPDSHSAQTFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFSSEEVQELREATLKEVDILQKVSGHPNIIQLKDTYETNTFF
100110120130140150160170180190
FLVFDLMKRGELFDYLTEKVTLTEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLQPGEKLREVCGTPSYLAPEIIQCSM
200210220230240250260270280290
DDGHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMDGKYQFGSPEWDDYSDTVKDLVSRFLVVQPQDRCSAEEALAHPFFQEYVVEEVRHFS
1
300310320330340350360370380
PRGKFKVICLTVLASVKIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVKKGQQQNRAALFENTPKAVLLSLAEEEDF
DescriptionPhosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform
Gene name(s)Phkg1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_035209.1
none loaded P07934
PHKG1_MOUSE
ENSMUST00000026617
none loaded GO:0050321
GO:0005978
GO:0005964
GO:0005524
GO:0004689

Peak Areas

Retention Times