Protein / Label:sp|Q8CE90|MP2K7_MOUSE
Description:Dual specificity mitogen-activated protein kinase kinase 7 OS=Mus musculus GN=Map2k7 PE=1 SV=1
Decoy:false
Note: 
File:Gadd45a_mouse_Suppl Spectral Viewer_v1_2016-05-22_15-58-51.sky.zip
0102030405060708090
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQLPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTP
100110120130140150160170180190
RSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFG
200210220230240250260270280290
TFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
300310320330340350360370380390
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYE
1
400410420430440450460470480490
ILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFSTSVTWGAWPLAAQTPFQSGVIRCRGRVPSPRRATGGSGGQPCVCAGGPGPSFTEMGPSPSPMLSN
500510520530
TFFTPDPGACPGASTWGLPRRRLCQLLTTSTPGCC
DescriptionDual specificity mitogen-activated protein kinase kinase 7 (short name: MAP kinase kinase 7)
Gene name(s)Map2k7
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001157644.1
NP_036074.2
NP_001036022.1
none loaded Q9R1Z6
Q9R1Z5
Q9R1Z4
Q9R1Z3
Q9QWG6
Q8CE90
Q8BSP1
O70243
O70242
O54780
O35872
O35871
O35720
O35406
MP2K7_MOUSE
ENSMUST00000145165
ENSMUST00000110999
ENSMUST00000110998
ENSMUST00000110996
ENSMUST00000110995
ENSMUST00000110994
ENSMUST00000062686
ENSMUST00000003027
none loaded GO:0072709
GO:0043525
GO:0018108
GO:0008545
GO:0007257
GO:0006915
GO:0005829
GO:0005737
GO:0005634
GO:0005524
GO:0004713
GO:0004708
GO:0004674
GO:0000287

Peak Areas

Retention Times