Protein / Label:sp|O08648|M3K4_MOUSE
Description:Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2
Decoy:false
Note: 
File:Gadd45a_mouse_Suppl Spectral Viewer_v1_2016-05-22_15-58-51.sky.zip
0102030405060708090
MRDAIAEPVPPPALADTPAAAMEELRPAPPPQPEPDPECCPAARQECMLGESARKSMESDPEDFSDETNTETLYGTSPPSTPRQMKRLSAKHQRNSAGRP
1
100110120130140150160170180190
ASRSNLKEKMNTPSQSPHKDLGKGVETVEEYSYKQEKKIRATLRTTERDHKKNAQCSFMLDSVAGSLPKKSIPDVDLNKPYLSLGCSNAKLPVSMPMPIA
2 1 2 1 4 >>
1
200210220230240250260270280290
RTARQTSRTDCPADRLKFFETLRLLLKLTSVSKKKDREQRGQENTAAFWFNRSNELIWLELQAWHAGRTINDQDLFLYTARQAIPDIINEILTFKVNYGS
> 1 1
300310320330340350360370380390
IAFSSNGAGFNGPLVEGQCRTPQETNRVGCSSYHEHLQRQRVSFEQVKRIMELLEYMEALYPSLQALQKDYERYAAKDFEDRVQALCLWLNITKDLNQKL
1 1
400410420430440450460470480490
RIMGTVLGIKNLSDIGWPVFEIPSPRPSKGYEPEDEVEDTEVELRELESGTEESDEEPTPSPRVPELRLSTDAILDSRSQGCVSRKLERLESEEDSIGWG
2 1 1 2 >>
500510520530540550560570580590
TADCGPEASRHCLTSIYRPFVDKALKQMGLRKLILRLHKLMNGSLQRARVALVKDDRPVEFSDFPGPMWGSDYVQLSGTPPSSEQKCSAVSWEELRAMDL
> 1 1
600610620630640650660670680690
PSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLGGLEKTDCNMDAFEEDLQKMLMVYFDYMRSWI
1 2
700710720730740750760770780790
QMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLESGLQESCAELWTSADDNGAADELRRSVIEISRALKELFHEAR
1 1 2 1
800810820830840850860870880890
ERASKALGFAKMLRKDLEIAAEFVLSASARELLDALKAKQYVKVQIPGLENLHVFVPDSLAEEKKIILQLLNAATGKDCSKDPDDVFMDAFLLLTKHGDR
1
900910920930940950960970980990
ARDSEDGWGTWEARAVKIVPQVETVDTLRSMQVDNLLLVVMESAHLVLQRKAFQQSIEGLMTVRHEQTSSQPIIAKGLQQLKNDALELCNRISDAIDRVD
1 1 2 1 1
2
1000101010201030104010501060107010801090
HMFTLEFDAEVEESESATLQQYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYISFAQKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISA
1 1 2
1100111011201130114011501160117011801190
LPEDDFLSLQALMNECIGHVIGKPHSPVTAIHRNSPRPVKVPRCHSDPPNPHLIIPTPEGFSTRSVPSDARTHGNSVAAAAAVAAAATTAAGRPGPGGGD
1 >>
1200121012201230124012501260127012801290
SVPAKPVNTAPDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRSDSSGSTRRSWELRTLISQTKDSASKQGPIEAIQKSVRLFEERRYRE
> 1 1 2 1
1300131013201330134013501360137013801390
MRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELH
1 2 1 1
1
1400141014201430144014501460147014801490
REEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYTKQITVAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAP
1 1 1 4 >>
4 >>
1500151015201530154015501560157015801590
EVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKAFLSHCLESDPKIRWTASQLLDHAFVKVCTDEE
> 1 1
>
DescriptionMitogen-activated protein kinase kinase kinase 4
Gene name(s)Map3k4
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_036078.2
none loaded Q6PDG6
O70124
O08649
O08648
M3K4_MOUSE
ENSMUST00000089058
none loaded GO:0060718
GO:0048471
GO:0048263
GO:0046872
GO:0043507
GO:0019100
GO:0010468
GO:0005737
GO:0005524
GO:0004709
GO:0004672
GO:0001890
GO:0000186
GO:0000165
PeptidePeptide Neutral MassMissed CleavagesAvg. Measured RTPredicted RTRT Score
QECMLGESAR1162.47470   
MNTPSQSPHKDLGK1538.75111   
MNTPSQSPHKDLGK1618.71751   
GVETVEEYSYK1302.59800   
GVETVEEYSYKQEK1687.79411   
NAQCSFMLDSVAGSLPK1823.85460   
NAQCSFMLDSVAGSLPK1839.84950   
SIPDVDLNKPYLSLGCSNAK2190.09910   
LPVSMPMPIAR1210.65660   
LPVSMPMPIAR1226.65150   
LPVSMPMPIAR1226.65150   
LPVSMPMPIAR1242.64650   
GQENTAAFWFNR1439.65820   
TINDQDLFLYTAR1568.78350   
VSFEQVKR991.54511   
YAAKDFEDR1113.50911   
IMGTVLGIK930.55720   
IMGTVLGIK946.55210   
GYEPEDEVEDTEVELR1907.82720   
LSTDAILDSR1089.56660   
LESEEDSIGWGTADCGPEASR2264.94920   
LESEEDSIGWGTADCGPEASR2344.91550   
LMNGSLQR933.47020   
CSAVSWEELR1235.56050   
LEQRPAGEPSLLSIK1636.91480   
TDCNMDAFEEDLQK1714.68150   
TDCNMDAFEEDLQK1730.67640   
NLLEEEWNFTK1421.68270   
EITHYIR930.49230   
LFCDIAGMLLK1279.66690   
LFCDIAGMLLK1295.66180   
ELFHEAR900.44540   
IILQLLNAATGK1253.77070   
DSEDGWGTWEAR1407.56910   
IVPQVETVDTLR1368.76130   
KAFQQSIEGLMTVR1606.85011   
KAFQQSIEGLMTVR1622.84501   
AFQQSIEGLMTVR1478.75510   
AFQQSIEGLMTVR1494.75010   
HEQTSSQPIIAK1337.69390   
NDALELCNR1103.50300   
EAMIQGYNFGFEYHK1848.81410   
IGDKYISFAQK1268.67651   
WMNYVLTK1053.53170   
WMNYVLTK1069.52670   
THGNSVAAAAAVAAAATTAAGRPGPGGGDSVPAKPVNTAPDTR3879.95760   
GSSVPENDR959.43080   
LASIAAELQFR1217.67680   
HSSPTEERDEPAYPR1769.79691   
HSSPTEERDEPAYPR1849.76321   
QGPIEAIQK965.51820   
KNIIGQVCDTPK1371.71801   
NIIGQVCDTPK1243.62310   
SYDNVMHVGLR1289.61870   
SYDNVMHVGLR1305.61360   
IGEGQYGK850.41850   
TIKETADELK1146.61321   
LGLQEHVIR1063.61380   
GANIFLTSSGLIK1319.74490   
LGDFGCSVK981.45900   
LKNNAQTMPGEVNSTLGTAAYMAPEVITR3076.53221   
LKNNAQTMPGEVNSTLGTAAYMAPEVITR3156.49851   
LKNNAQTMPGEVNSTLGTAAYMAPEVITR3092.52711   
LKNNAQTMPGEVNSTLGTAAYMAPEVITR3092.52711   
NNAQTMPGEVNSTLGTAAYMAPEVITR2835.35310   
NNAQTMPGEVNSTLGTAAYMAPEVITR2915.31950   
NNAQTMPGEVNSTLGTAAYMAPEVITR2851.34800   
NNAQTMPGEVNSTLGTAAYMAPEVITR2851.34800   
VGMGHKPPIPER1316.70230   
AFLSHCLESDPK1402.65510   

Peak Areas

Retention Times