Protein / Label:sp|P52480|KPYM_MOUSE
Description:Pyruvate kinase isozymes M1/M2 OS=Mus musculus GN=Pkm2 PE=1 SV=4
Decoy:false
Note: 
File:Gadd45a_mouse_Suppl Spectral Viewer_v1_2016-05-22_15-58-51.sky.zip
0102030405060708090
MPKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFAS
100110120130140150160170180190
DPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKEKGADFLVTEVENG
200210220230240250260270280290
GSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
1 >>
300310320330340350360370380390
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRR
>
400410420430440450460470480490
LAPITSDPTEAAAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLNAWAEDVDLRVNLAMDVGKAR
500510520530
GFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
DescriptionPyruvate kinase PKM
Gene name(s)Pkm2, Pkm
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_035229.2
NP_001240812.1
none loaded Q9CWB1
Q91YI8
Q64484
Q4VC20
Q3U5P6
Q3U1X3
Q3TC59
Q3TBW5
Q3TBV8
P52480
KPYM_MOUSE
ENSMUST00000163694
ENSMUST00000034834
none loaded GO:0070062
GO:0030955
GO:0012501
GO:0006096
GO:0005929
GO:0005886
GO:0005739
GO:0005634
GO:0005524
GO:0004743
GO:0000287

Peak Areas

Retention Times