Protein / Label:sp|P18826|KPB1_MOUSE
Description:Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Mus musculus GN=Phka1 PE=1 SV=3
Decoy:false
Note: 
File:Gadd45a_mouse_Suppl Spectral Viewer_v1_2016-05-22_15-58-51.sky.zip
0102030405060708090
MRSRSNSGVRLDGYARLVHQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLAYRKNADRDEDKAKAYELEQSVVKLMRGLLHCMIRQVDKVE
100110120130140150160170180190
SFKYSQSTKDSLHAKYNTKTCATVVGDDQWGHLQLDATSVYLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTADFGIWERGDKTNQGISELNAS
200210220230240250260270280290
SVGMAKAALEALDELDLFGVKGGPQSVIHVLADEVQHCQSILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSHLVELTKQEIITKLQGRYGCCRFLRDG
300310320330340350360370380390
YKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGIFSGNVEQVQEYREALDAVLIKGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPH
400410420430440450460470480490
MWGQSLYILGSLMAEGFLAPGEIDPLNRRFSTVPKPDVVVQVSILAETEEIKAILKDKGIDVETIAEVYPIRVQPARILSHIYSSLGCNSRMKLSGRPYR
500510520530540550560570580590
LMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNQMIVEMLRTDLSYLCSRWRMTGQPTITFPISHTMLDEDGTSLNSSILAALRKMQDGYFGGARIQ
600610620630640650660670680690
TGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDEDYEDDLDSGNWMDSYDSTSNARCGDEVARYLDRLLAHTVPHPKLAPTSRKGGLDRFRAAVQTTCDL
700710720730740750760770780790
MSLVAKAKELHIQNVHMYLPTKLFQPSRPSLNLLDSPESPQDSQVPSVHVEVHLPRDQSGEVDFQSLVSQLKETSSLQEQADILYMLYSMKGPDWNTELY
800810820830840850860870880890
EEGGATVRELLSELYVKVGEIRHWGLIRYISGILRKKVEALDEACTDLLSYQKHLTVGLPPEPREKTISAPLPYEALTKLIDEASEGDMSISTLTQEIMV
900910920930940950960970980990
YLAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHHILSGKEFGVERSVRPTDSNVSPAISIHEIGAVGATKTER
1000101010201030104010501060107010801090
TGIMQLKSEIKQVEFRRLSVSMESQTSGGHPSGVDLMSPSFLSPAACIAASSGSFPTVCDHQTSKDSRQGQWQRRRRLDGALNRVPIGFYQKVWKILQKC
1100111011201130114011501160117011801190
HGLSVEGFVLPSSTTREMTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADIEIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDTMLAKDPAS
1
12001210122012301240
GICTLLYDSAPSGRFGTMTYLSKAAATYVQEFLPHSLCAMQ
DescriptionPhosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform (short name: Phosphorylase kinase alpha M subunit)
Gene name(s)Phka1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_032858.2
none loaded P18826
A2AI90
KPB1_MOUSE
ENSMUST00000113611
ENSMUST00000052012
none loaded GO:0005977
GO:0005886
GO:0004553

Peak Areas

Retention Times