Protein / Label:sp|P07310|KCRM_MOUSE
Description:Creatine kinase M-type OS=Mus musculus GN=Ckm PE=1 SV=1
Decoy:false
Note: 
File:Gadd45a_mouse_Suppl Spectral Viewer_v1_2016-05-22_15-58-51.sky.zip
0102030405060708090
MPFGNTHNKFKLNYKPQEEYPDLSKHNNHMAKVLTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGY
1
100110120130140150160170180190
KPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSP
200210220230240250260270280290
LLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLA
300310320330340350360370380
NLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
DescriptionCreatine kinase M-type
Gene name(s)Ckm
Organisms Rattus norvegicus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_036662.1
none loaded P07310
Q6P6R9
P00564
KCRM_MOUSE
KCRM_RAT
ENSRNOT00000022895
none loaded GO:0046314
GO:0005737
GO:0005524
GO:0004111

Peak Areas

Retention Times