Protein / Label:sp|Q9R0Y5-2|KAD1_MOUSE
Description:Isoform 2 of Adenylate kinase isoenzyme 1 OS=Mus musculus GN=Ak1
Decoy:false
Note: 
File:Gadd45a_mouse_Suppl Spectral Viewer_v1_2016-05-22_15-58-51.sky.zip
0102030405060708090
MGCCVSSEPQEEGGRKTGEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKV
<
100110120130140150160170180190
DSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFS
<< 1
200
EVCTYLDSLK
DescriptionIsoform 2 of Adenylate kinase isoenzyme 1 OS=Mus musculus GN=Ak1
Gene name(s)Ak1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded none loaded none loaded none loaded none loaded none loaded

Peak Areas

Retention Times