Protein / Label:tr|Q5LRJ4|Q5LRJ4_RUEPO
Description:Outer membrane protein, putative OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=SPO2133 PE=4 SV=1
Decoy:false
Note: 
File:Detection of Low Abundance Ocean Bacteria Peptides DIA_2016-08-08_14-19-56.sky.zip
0102030405060708090
MARSRTMKLLVPALVAVSMAAAPAMAGDWSGAYLGLGVGYGDADGPGARDGEAASFGGHIGYNFDLGNRFVMGGELEYDRVNNDLGAGGGTLDEIGRLKV
1 1
100110120130140150160170
KAGYDFGPVLGYGVLGAARATSTFGNENGLVYGLGLAMPVTDYLSVSGEVLRHQFKDFGGAGNDFDVNTFNLRASLRF
1
DescriptionOuter membrane protein, putative OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=SPO2133 PE=4 SV=1
Gene name(s)SPO2133
Organisms Unknown unknown

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded Q5LRJ4
Q5LRJ4_RUEPO
none loaded none loaded none loaded

Peak Areas

Retention Times