Protein / Label:tr|Q5LSB9|Q5LSB9_RUEPO
Description:Branched-chain amino acid ABC transporter, ATP-binding protein OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=SPO1849 PE=4 SV=1
Decoy:false
Note: 
File:Detection of Low Abundance Ocean Bacteria Peptides DIA_2016-08-08_14-19-56.sky.zip
0102030405060708090
MSLLELENVTLKFGGLTAVDNLSFSVEEGEVFAIVGPNGAGKSTVFNLISRFYDPYAGQIRFDGHNLLEVKPSGVAAYGVARTFQNIELFEHATVLQNLL
1
100110120130140150160170180190
VGRHRHRRTNLFSEIFFTPSARRQEMENREKVEEIIDFLDLQAYRDKYIAGLPYGVRKVVEVARALATDPKLLLLDEPASGLSVEETNDMRWWIDDIRRQ
1
200210220230240250
MGITVLMVEHDMGLVSGVSDRVLAMADGAKLALGTPAQVQSDPAVIEAYLGKAA
1
DescriptionBranched-chain amino acid ABC transporter, ATP-binding protein OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=SPO1849 PE=4 SV=1
Gene name(s)SPO1849
Organisms Unknown unknown

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded Q5LSB9
Q5LSB9_RUEPO
none loaded none loaded none loaded

Peak Areas

Retention Times