Protein / Label:sp|Q5LN23|PNP_RUEPO
Description:Polyribonucleotide nucleotidyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pnp PE=3 SV=1
Decoy:false
Note: 
File:Detection of Low Abundance Ocean Bacteria Peptides DIA_2016-08-08_14-19-56.sky.zip
0102030405060708090
MFDVTTKSMQWGEETLTLESGKIARQADGSVVATLGETRVMANVTFAREQKPGQDFFPLTVHYQEKYYAAGKVPGGFFKREARPTEKETLTARLIDRPIR
1
100110120130140150160170180190
PLFVPGFKNEVLVMCTVLSHDLVNDPDIVAMIAASAALTISGVPFMGPIAGCRVGYVDGEYVLNPTVDDMQDLRLNPEQRLDLVVAGTKDAVMMVESEAY
1 1
200210220230240250260270280290
ELTEAEMLGAVTFAHAQIQPVVDLIVSFAEQCAKEPFDFTPPDYSDLYAAVKAAGEEQMRAAFAITDKQERTAAVAAAREAIKAALTEEQLADGNLGSAL
300310320330340350360370380390
KKLEAGILRGDVVKGGKRIDGRDTTTVRPIVAETGLLPRTHGSALFTRGETQGLVVTTLGTGDDEQFIDALHGNFKSNFLLHYNFPPYSVGEVGRVGSPG
400410420430440450460470480490
RREIGHGKLAWRALQAVLPAPTDFPYTIRVVSEITESNGSSSMASVCGGSLSMMDAGVPLKSAVAGVAMGLILEDDGSYAVLTDILGDEDHLGDMDFKVA
500510520530540550560570580590
GTENGITSLQMDIKVAGITPEIMEKALSQAKDGRMHILAEMNKALSGAADFSVHAPRIETMQIPTDKIREVIGSGGKVIREIVEVSGAKVDINDDGIIKI
600610620630640650660670680690
ASPNGDSIKKAYDMIWSIVAEPEEGQVYTGKVVKIVDFGAFVNFFGKRDGLVHVSQIENRRLNHPSDVLKEGQEVKVKLLGFDDRGKVRLSMKVVDQETG
700710
EEIVPEKKEASEAE
DescriptionPolyribonucleotide nucleotidyltransferase
Gene name(s)pnp
Organisms

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
YP_168585.1
none loaded Q5LN23
PNP_RUEPO
none loaded none loaded GO:0090503
GO:0006402
GO:0006396
GO:0005737
GO:0004654
GO:0003723
GO:0000287
GO:0000175

Peak Areas

Retention Times